Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drome-CG13772

Drosophila melanogaster (Fruit fly) Neuroligin 2 CG13772 Nlg2 dnl2, DNlg2, dnlg2 homologous to neuroligins rh63339p

Comment
Nucleotide sequence from Celera only n-term Pfam A COesterase 157 729


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Drosophila melanogaster
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AE003615, AAF68455, AF251479
2 Ncbi-pid : 7297184, 7716610
2 UniProt : Q9NGK5, Q6NR70
2 Interpro : Q9NGK5, Q6NR70
2 Prodom : Q9NGK5, Q6NR70
2 Pfam : Q9NGK5, Q6NR70
2 PIRSF : Q9NGK5, Q6NR70
2 SUPERFAM : Q9NGK5, Q6NR70
1 FlyBase : 0031866
Sequence
Graphical view for this peptide sequence: drome-CG13772
Colored MSA for Neuroligin (raw)
MPPITPSTWKTVRSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRL
LPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPKTKLSTVVFIHGES
YDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLM
DLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQR
TVLVSGSALSPWAIQKNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVA
ELLAVKVDHPRFLVGFAPFVDGTVISPGANPLGSTTLPLGSAIVSTSGIE
YANFPKRDLIFCLTSVESYLDLSAQDLEFGFNETRRDRILRTFVRNNFHY
HLNEIFAVLKNEYTDWEKAIRNPLSSRDATLQFLSDGHTASPLIKLGYMH
SLRGGRAYFLHFKHKTIEEEYPQRSGSVRGEDVPFWLGLPMSPLFPHNYT
TQERQIGRLINPNQSTAKSVLPNPNEVLETALHQQKKRSTSLTHPNLSEA
LNLAVLYNQRRSNAMHEKRSYIRRRLRSNDAAFTQLGISSERDVGSYDGD
ELPFWDAYDVVNQLYVELGNKANIQSHYRGHKLSMWLNLIPQLHRHFNIN
DQSMRHHQFQDDMNNRDLYEGVVRPQLQTKPAEDDNIIIMQRSRTTTPPP
PSKNPSTNATQALNPLGTGTPTTTECGIDGAMSVSELTTTQSPKDNRTGI
VRVETQKDLATASTGIIGNLELLRRLGGKQFQSYTTALIATVAVGCFLLI
LNVLIFAGIYHQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPPITPSTWKTVRSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRL
LPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPKTKLSTVVFIHGES
YDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLM
DLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQR
TVLVSGSALSPWAIQKNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVA
ELLAVKVDHPRFLVGFAPFVDGTVISPGANPLGSTTLPLGSAIVSTSGIE
YANFPKRDLIFCLTSVESYLDLSAQDLEFGFNETRRDRILRTFVRNNFHY
HLNEIFAVLKNEYTDWEKAIRNPLSSRDATLQFLSDGHTASPLIKLGYMH
SLRGGRAYFLHFKHKTIEEEYPQRSGSVRGEDVPFWLGLPMSPLFPHNYT
TQERQIGRLINPNQSTAKSVLPNPNEVLETALHQQKKRSTSLTHPNLSEA
LNLAVLYNQRRSNAMHEKRSYIRRRLRSNDAAFTQLGISSERDVGSYDGD
ELPFWDAYDVVNQLYVELGNKANIQSHYRGHKLSMWLNLIPQLHRHFNIN
DQSMRHHQFQDDMNNRDLYEGVVRPQLQTKPAEDDNIIIMQRSRTTTPPP
PSKNPSTNATQALNPLGTGTPTTTECGIDGAMSVSELTTTQSPKDNRTGI
VRVETQKDLATASTGIIGNLELLRRLGGKQFQSYTTALIATVAVGCFLLI
LNVLIFAGIYHQR


References
    Title: Drosophila Neuroligin 2 is Required Presynaptically and Postsynaptically for Proper Synaptic Differentiation and Synaptic Transmission
    Chen YC, Lin YQ, Banerjee S, Venken K, Li J, Ismat A, Chen K, Duraine L, Bellen HJ, Bhat MA
    Ref: Journal of Neuroscience, 32:16018, 2012 : PubMed

            

    Title: Neuroligin 2 is required for synapse development and function at the Drosophila neuromuscular junction
    Sun M, Xing G, Yuan L, Gan G, Knight D, With SI, He C, Han J, Zeng X and Xie W <2 more author(s)>
    Ref: Journal of Neuroscience, 31:687, 2011 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer