Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drome-CG15101

Drosophila melanogaster (Fruit fly) gh06241p JHEH1 epoxide hydrolase (EC 3.3.2.3)

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Drosophila melanogaster
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AY058299, AE003798, AF517545
1 UniProt : Q95U55
1 Interpro : Q95U55
1 Prodom : Q95U55
1 Pfam : Q95U55
1 PIRSF : Q95U55
1 SUPERFAM : Q95U55
2 FlyBase : 0034404, 0010053
Sequence
Graphical view for this peptide sequence: drome-CG15101
Colored MSA for Epoxide_hydrolase (raw)
MGVTVKILVLILAIAGGLVYRNVTQLWADLPAPKLDPQEWWGDEAQPKDY
EAYLKNNSEVIGNRLSYPDKTIADLKERLNRTLRLTPPLEGVAFEYGFNT
NYLKEVVEYWRDDYLPRWREREVFLWQFNHFTTDIQGLRTHFLHLMVYDD
NKVGKKHYPVLLLHGWPGSVREFYDFIHLLHQTNLDNNNKYIFNVVVPSL
PGYGWSQGTSRKGLGPAQVAVMMRNLMLRLGYNKFFIQGGDWGSIIGSNI
ATLYPENVLGYHSNMCNNLSPKSLAKGLVAEFWPSLFVPSGFEDFFFPKS
NEMRYLMEESGYFHIQATKPDTIGAALTDNPVGLAAYILEKFSTWTNPSY
RSLPDGGLTKRYKMDALLDNLMIYYLTNSITTSQRLYAEQYAQAQRDLHL
DRVPTRVPTGCARFKSDIMQFLDVQLKDKYTNLVHSTYHKKGGHFAALEV
PKVLYKDFIDFVETVERKFKIKTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVTVKILVLILAIAGGLVYRNVTQLWADLPAPKLDPQEWWGDEAQPKDY
EAYLKNNSEVIGNRLSYPDKTIADLKERLNRTLRLTPPLEGVAFEYGFNT
NYLKEVVEYWRDDYLPRWREREVFLWQFNHFTTDIQGLRTHFLHLMVYDD
NKVGKKHYPVLLLHGWPGSVREFYDFIHLLHQTNLDNNNKYIFNVVVPSL
PGYGWSQGTSRKGLGPAQVAVMMRNLMLRLGYNKFFIQGGDWGSIIGSNI
ATLYPENVLGYHSNMCNNLSPKSLAKGLVAEFWPSLFVPSGFEDFFFPKS
NEMRYLMEESGYFHIQATKPDTIGAALTDNPVGLAAYILEKFSTWTNPSY
RSLPDGGLTKRYKMDALLDNLMIYYLTNSITTSQRLYAEQYAQAQRDLHL
DRVPTRVPTGCARFKSDIMQFLDVQLKDKYTNLVHSTYHKKGGHFAALEV
PKVLYKDFIDFVETVERKFKIKTL


References
    Title: Cloning and Characterization of Drosophila melanogaster Juvenile Hormone Epoxide Hydrolases (JHEH) and Their Promoters
    Borovsky D, Breyssens H, Buytaert E, Peeters T, Laroye C, Stoffels K, Rouge P
    Ref: Biomolecules, 12:991, 2022 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer