drome-CG1882

 
Drosophila melanogaster (Fruit fly) Pummelig (Puml) phospholipase

Comment
Renamed Pummelig (Puml),colloquial German for chubby) pummelig deletion mutants (puml1) Hehlert et al..Pummelig release fatty acids from phosphatidic acid (PA), N-acylphosphatidylethanolamine (NAPE) and phosphatidylglycerol (PG) but does not hydrolyse TG, diolen or monoolein. Pummelig localizes to lipid droplets, mitochondria, and peroxisomes. Puml does not stimulate TG lipase activity of Bmm (Brummer DmATGL) in vitro


Relationship
Block X
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: NBD-HE-HP ,
2 Genbank : AE003839, 24586385
2 UniProt : Q5U191, Q7JQU9
2 UniProtTrembl : Q5U191, Q7JQU9
2 Interpro : Q5U191, Q7JQU9
2 Prodom : Q5U191, Q7JQU9
2 Pfam : Q5U191, Q7JQU9
2 PIRSF : Q5U191, Q7JQU9
2 SUPERFAM : Q5U191, Q7JQU9
2 QuickSwissBlast : Q5U191, Q7JQU9
1 FlyBase : 0033226
 
Sequence
Graphical view for this peptide sequence: drome-CG1882
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MSEPLALASGGVVDPTAASTSVTISNLPQPTVALGSESKSSMDLEDPRNN
RFFLWKWLCNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADK
IWTISMNTESKEVPLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFG
RSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYA
LSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWA
LRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGES
AFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQ
RGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCDMYKVAGGKLITPLQL
IRESTESDEEREPSLSTAKTVEVQPEVQPVPQPVTAADTSTPTADELAAN
IKPK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEPLALASGGVVDPTAASTSVTISNLPQPTVALGSESKSSMDLEDPRNN
RFFLWKWLCNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADK
IWTISMNTESKEVPLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFG
RSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYA
LSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWA
LRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGES
AFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQ
RGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCDMYKVAGGKLITPLQL
IRESTESDEEREPSLSTAKTVEVQPEVQPVPQPVTAADTSTPTADELAAN
IKPK

no DNA




References
    Title: The alpha/beta-hydrolase domain-containing 4- and 5-related phospholipase Pummelig controls energy storage in Drosophila
    Hehlert P, Hofferek V, Heier C, Eichmann TO, Riedel D, Rosenberg J, Takacs A, Nagy HM, Oberer M and Kuhnlein RP <1 more author(s)>
    Ref: J Lipid Res, 60:1365, 2019 : PubMed

            

    Title: Functional fat body proteomics and gene targeting reveal in vivo functions of Drosophila melanogaster a-Esterase-7
    Birner-Gruenberger R, Bickmeyer I, Lange J, Hehlert P, Hermetter A, Kollroser M, Rechberger GN, Kuhnlein RP
    Ref: Insect Biochemistry & Molecular Biology, 42:220, 2012 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer