drome-CG3841

 
Drosophila melanogaster (Fruit fly) CG3841 AT14896p carboxylesterase homologous to este4 contigous to CG4382

Comment
Nucleotide sequence from Celera


Relationship
Block C
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 2 more: AE003625, AAO39645, BT001499
2 Ncbi-pid : 7297536, 28317295
2 UniProtTrembl : Q9VLA4, Q86NU1
2 Interpro : Q9VLA4, Q86NU1
2 Prodom : Q9VLA4, Q86NU1
2 Pfam : Q9VLA4, Q86NU1
2 PIRSF : Q9VLA4, Q86NU1
2 SUPERFAM : Q9VLA4, Q86NU1
2 QuickSwissBlast : Q9VLA4, Q86NU1
1 FlyBase : 0032131
 
Sequence
Graphical view for this peptide sequence: drome-CG3841
Colored MSA for Carb_B_Arthropoda (raw)
MPRFFQLTWALLLILIGFTTAVTFIGDDPVVELSLGRIQGDTMQSFGNKT
IYAFRGIRYAQSPVGQLRFANPVPETSWGDEVFNATSDSLVCPQPGVVSL
MSEDCLKINVFTKSFEDKFPVMVYIHGGANVLGSGHSSYEAGPQYLLDQD
VVFVAFNYRLGALGFLSTNSSETKGNFGFLDQVMALEWVRDHISHFGGDP
ELVTIIGISAGSMAVSLHLASPLSAGLFHRAILMSGSATNHFDIDNLFWT
RKLARELGCPMYDPTDVVECLRNETWTRIVEVCKAWETYQLVNMKWNYEI
DGHFLHNHPTELIKEGNFNKVPLLISFTANEFDYNANVHLENQHLLHDFA
SNFVDYAPELFLYRHDAQIGEKLKDFYLGDNTTEINSENIENFGQIFSDA
YIGHGVHRLVQLASHFTPVYYTRMDYVGDQSLSAPLNGENKPVGVGHADD
LHYVLPGYWYGPLMAANDSDVFMMERLTSWFTHFAKTGTPLNSTDIWPPC
NSTVLKMLYNGVVTQVGSPGYSNRYAVWDKLFPTAAQGGGAALKLSFAVA
IATGVASRLIGKLM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPRFFQLTWALLLILIGFTTAVTFIGDDPVVELSLGRIQGDTMQSFGNKT
IYAFRGIRYAQSPVGQLRFANPVPETSWGDEVFNATSDSLVCPQPGVVSL
MSEDCLKINVFTKSFEDKFPVMVYIHGGANVLGSGHSSYEAGPQYLLDQD
VVFVAFNYRLGALGFLSTNSSETKGNFGFLDQVMALEWVRDHISHFGGDP
ELVTIIGISAGSMAVSLHLASPLSAGLFHRAILMSGSATNHFDIDNLFWT
RKLARELGCPMYDPTDVVECLRNETWTRIVEVCKAWETYQLVNMKWNYEI
DGHFLHNHPTELIKEGNFNKVPLLISFTANEFDYNANVHLENQHLLHDFA
SNFVDYAPELFLYRHDAQIGEKLKDFYLGDNTTEINSENIENFGQIFSDA
YIGHGVHRLVQLASHFTPVYYTRMDYVGDQSLSAPLNGENKPVGVGHADD
LHYVLPGYWYGPLMAANDSDVFMMERLTSWFTHFAKTGTPLNSTDIWPPC
NSTVLKMLYNGVVTQVGSPGYSNRYAVWDKLFPTAAQGGGAALKLSFAVA
IATGVASRLIGKLM

no DNA




Reference
    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer