drome-CG6271

 
Drosophila melanogaster (Fruit fly) gene lipase

Comment
Nucleotide sequence from Celera. Belongs to a cluster with CG6296 and CG6295 on AE003758 genes 25 and 26 and on AE003759 CG17192 CG17191 CG6283 CG6277 CG6271 genes 1 2 3 4 and 5


Relationship
Block L
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AE003759
1 Ncbi-pid : 7301533
1 UniProtTrembl : Q9VB88
1 Interpro : Q9VB88
1 Prodom : Q9VB88
1 Pfam : Q9VB88
1 PIRSF : Q9VB88
1 SUPERFAM : Q9VB88
1 QuickSwissBlast : Q9VB88
1 FlyBase : 0039476
 
Sequence
Graphical view for this peptide sequence: drome-CG6271
Colored MSA for Insect_lipase (raw)
MKTFLILAIFALAASAYALEESERVNGENGWYVPQQDGSFEWVDMDVAEE
WMEAQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAH
PTRFVIHGWTQSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSV
MAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQ
VHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKG
AFYPNGGKTQPGCPLDVTGACSHGRSTTYYAEAVSEDNFGTMKCGDYEEA
VAKECGSTYSSVRMGADTNAYMVEGDFYVPVNSKAPFGMIN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTFLILAIFALAASAYALEESERVNGENGWYVPQQDGSFEWVDMDVAEE
WMEAQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAH
PTRFVIHGWTQSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSV
MAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQ
VHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKG
AFYPNGGKTQPGCPLDVTGACSHGRSTTYYAEAVSEDNFGTMKCGDYEEA
VAKECGSTYSSVRMGADTNAYMVEGDFYVPVNSKAPFGMIN

no DNA




Reference
    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer