drome-CG8425

 
Drosophila melanogaster (Fruit fly) CG8425 juvenile hormone esterase

Comment
Q3ZAK4 difference prt missing in the middle of the sequence Annotation from Dr Peter Campbell : There is an error in the sequence as predicted by the genome project which they should correct soon. The sixth predicted intron is not removed; instead there is a stop codon and poly A site. This makes the protein the usual length for an esterase rather than 50% too long. CG8425 DmJHEdup appears to be a duplication of CG8424. CG8424 is a juvenile hormone esterase. DmJHE is the hormone esterase with precise regulation and highly specific activity for its substrate, juvenile hormone. DmJHEdup is an odorant degrading esterase (ODE) responsible for processing various kairomones in antennae


Relationship
Block C
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: NBD-HE-HP ,
>3 Genbank links 2 more: AE003808, AF304352, BT023865
3 UniProt : Q9BMT7, A1ZA98, Q3ZAK4
2 Ncbi-pid : 7302991, 12802348
3 UniProtTrembl : Q9BMT7, A1ZA98, Q3ZAK4
3 Interpro : Q9BMT7, A1ZA98, Q3ZAK4
3 Prodom : Q9BMT7, A1ZA98, Q3ZAK4
3 Pfam : Q9BMT7, A1ZA98, Q3ZAK4
3 PIRSF : Q9BMT7, A1ZA98, Q3ZAK4
3 SUPERFAM : Q9BMT7, A1ZA98, Q3ZAK4
3 QuickSwissBlast : Q9BMT7, A1ZA98, Q3ZAK4
1 FlyBase : 0034077
 
Sequence
Graphical view for this peptide sequence: drome-CG8425
Colored MSA for Juvenile_hormone_esterase (raw)
MLQLLLLGQLLAGPGPFCAALATVDQLTVCPPSVGCLKGTNLQGYQSERF
EAFMGIPYALPPIGDLRFSNPKVMPKLLGMYDASAPKMDCIQKNYLLPTP
VVYGDEDCLYLNVYRPEIRKSALPVMVYIHGGGFFGGSAGPGVTGPEYFM
DSGEVILVTMAYRLGPFGFLSTQDAVMSGNFGLKDQNLALRWVQRNIRFF
GGDPQRVTIFGQSAGGVAAHMHLLSPRSHGLFHRVISMSGTANVPFAIAE
QPLEQARLLAEFADVPDARNLSTVKLTKALRRINATKLLNAGDGLKYWDV
DHMTNFRPVVEEGLEVDAFLNAHPMDMLAQGMPTSIPLLLGTVPGEGAVR
VVNILGNETLRQSFNLRFDELLQELLEFPASFSQDRREKMMDLLVEVYFQ
GQHEVNELTVQGFMNLISDRGFKQPLYNTIHKNVCHTPNPVYLYSFNYQG
PLSYASAYTSANVTGKYGVVHCDDLLYLFRSPLLFPDFQRNSTEAKVIHS
FVDYFVHFAKFGKPRNSVLLTPCSIEVLQSRPDGICDYHEFANAPDAYQG
FEVHVASEFQTDRVNWSHILNEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLQLLLLGQLLAGPGPFCAALATVDQLTVCPPSVGCLKGTNLQGYQSERF
EAFMGIPYALPPIGDLRFSNPKVMPKLLGMYDASAPKMDCIQKNYLLPTP
VVYGDEDCLYLNVYRPEIRKSALPVMVYIHGGGFFGGSAGPGVTGPEYFM
DSGEVILVTMAYRLGPFGFLSTQDAVMSGNFGLKDQNLALRWVQRNIRFF
GGDPQRVTIFGQSAGGVAAHMHLLSPRSHGLFHRVISMSGTANVPFAIAE
QPLEQARLLAEFADVPDARNLSTVKLTKALRRINATKLLNAGDGLKYWDV
DHMTNFRPVVEEGLEVDAFLNAHPMDMLAQGMPTSIPLLLGTVPGEGAVR
VVNILGNETLRQSFNLRFDELLQELLEFPASFSQDRREKMMDLLVEVYFQ
GQHEVNELTVQGFMNLISDRGFKQPLYNTIHKNVCHTPNPVYLYSFNYQG
PLSYASAYTSANVTGKYGVVHCDDLLYLFRSPLLFPDFQRNSTEAKVIHS
FVDYFVHFAKFGKPRNSVLLTPCSIEVLQSRPDGICDYHEFANAPDAYQG
FEVHVASEFQTDRVNWSHILNEK

Graphical view for this nucleotide DNA sequence (1921 bp): drome-CG8425



References
3 more
    Title: The molecular basis for the neofunctionalization of the juvenile hormone esterase duplication in Drosophila
    Hopkins DH, Rane RV, Younus F, Coppin CW, Pandey G, Jackson CJ, Oakeshott JG
    Ref: Insect Biochemistry & Molecular Biology, 106:10, 2019 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            

    Title: Purification and kinetic characterisation of juvenile hormone esterase from Drosophila melanogaster
    Campbell PM, Oakeshott JG, Healy MJ
    Ref: Insect Biochemistry & Molecular Biology, 28:501, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer