drome-KRAKEN

 
Drosophila melanogaster (Fruit fly) probable serine hydrolase (EC 3.1.-.-) (kraken protein)

Comment
May have a role in detoxification and digestion during embryogenesis and larval development. Ubiquitously expressed before embryonic stage 11. At stage 11, expression is concentrated in the foregut and posterior midgut. By stage 15, in gastric caeca, pharynx, posterior spiracles and anterior edge of midgut. At the end of embryogenesis, expression is confined to gastric caeca. During third instar larvae, expressed at low levels in gastric caeca, midgut and hindgut and high level in fat body. Highest expression level in adult Malpighian tubule


Relationship
Family SERHL
Block X
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 4 more: AJ000516, AE003588, AY095092
2 UniProt : O18391, M9PBM0
2 UniProtTrembl : O18391, M9PBM0
2 Interpro : O18391, M9PBM0
2 Prodom : O18391, M9PBM0
2 Pfam : O18391, M9PBM0
2 PIRSF : O18391, M9PBM0
2 SUPERFAM : O18391, M9PBM0
2 QuickSwissBlast : O18391, M9PBM0
1 FlyBase : 0020545
 
Sequence
Graphical view for this peptide sequence: drome-KRAKEN
Colored MSA for SERHL (raw)
MGQTRVAATTAAQSPAAELSPETNGQTEEPLQLLGEDSWEEFSIAVPWGT
VEAKWWGSKERQPIIALHGWQDNCGSFDRLCPLLPADTSILAIDLPGHGK
SSHYPMGMQYFIFWDGICLIRRIVRKYNWKNVTLLGHSLGGALTFMYAAS
FPTEVEKLINIDIAGPTVRGTQRMAEGTGRALDKFLDYETLPESKQPCYS
YDEMIKLVLDAYDGSVDEPSVRVLMNRGMRHNPSKNGYLFARDLRLKVSL
LGMFTAEQTLAYARQIRCRVLNIRGIPGMKFETPQVYADVIATLRENAAK
VVYVEVPGTHHLHLVTPDRVAPHIIRFLKEA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGQTRVAATTAAQSPAAELSPETNGQTEEPLQLLGEDSWEEFSIAVPWGT
VEAKWWGSKERQPIIALHGWQDNCGSFDRLCPLLPADTSILAIDLPGHGK
SSHYPMGMQYFIFWDGICLIRRIVRKYNWKNVTLLGHSLGGALTFMYAAS
FPTEVEKLINIDIAGPTVRGTQRMAEGTGRALDKFLDYETLPESKQPCYS
YDEMIKLVLDAYDGSVDEPSVRVLMNRGMRHNPSKNGYLFARDLRLKVSL
LGMFTAEQTLAYARQIRCRVLNIRGIPGMKFETPQVYADVIATLRENAAK
VVYVEVPGTHHLHLVTPDRVAPHIIRFLKEA

no DNA




References
7 more
    Title: A Drosophila full-length cDNA resource
    Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J and Celniker SE <3 more author(s)>
    Ref: Genome Biol, 3:RESEARCH0080, 2002 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            

    Title: Identification and characterization of kraken, a gene encoding a putative hydrolytic enzyme in Drosophila melanogaster
    Edwin Chan HY, Harris SJ, O'Kane CJ
    Ref: Gene, 222:195, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer