Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drome-aes05

Drosophila melanogaster (Fruit fly) gh12017p alpha esterase (aE5) CG1089-PA GH12017p

Comment
Nucleotide sequence of the Celera sequence differs from the published sequence for this transcript


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Drosophila melanogaster
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
NBD-HE-HP
>3 Genbank links 5 more: AAL13574, AAF54006, U51047
1 Ncbi-nid : 1272307
3 Ncbi-pid : 28381147, 16197859, 7298797
3 UniProt : Q95U30, Q24198, A0A0B4K6V8
3 Interpro : Q95U30, Q24198, A0A0B4K6V8
3 Prodom : Q95U30, Q24198, A0A0B4K6V8
3 Pfam : Q95U30, Q24198, A0A0B4K6V8
3 PIRSF : Q95U30, Q24198, A0A0B4K6V8
3 SUPERFAM : Q95U30, Q24198, A0A0B4K6V8
1 FlyBase : 0015573
Sequence
Graphical view for this peptide sequence: drome-aes05
Colored MSA for Carb_B_Arthropoda (raw)
MSKESSLETCELTLPVGQIKGVKRLSLYDDPYFSFEKIPFAKTPLGELRF
RAPVPADPWSGVLDCTHYAEKPTQRGLLTREIEGGEDCLYLNVYSKQLKS
EKPLPVMVYIYGGAFTVGEATRELYGPDYFMTKDVVLVTLNYRVDCLGFL
SLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGESAGGCS
THFMMCTEQTRGLFHKAIPMSGTVHNYWANNPAEDFAFRLAQQNGFTGEN
DDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVV
PKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTR
LVPVDVRTVSSEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFW
HGFNRTFNARLTYAKAPTYYYRFDFDSPNFNFYRAKFCGDKIKTGVAHAD
DLSYLFRNAGSWKLDKTSAEYRTIERMIGIWTAFAATSNPNCPEIGHLEW
KPSTKNDPKRVINISSDVTIIDLPEYEKLQIWDNLYKPNQLI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKESSLETCELTLPVGQIKGVKRLSLYDDPYFSFEKIPFAKTPLGELRF
RAPVPADPWSGVLDCTHYAEKPTQRGLLTREIEGGEDCLYLNVYSKQLKS
EKPLPVMVYIYGGAFTVGEATRELYGPDYFMTKDVVLVTLNYRVDCLGFL
SLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGESAGGCS
THFMMCTEQTRGLFHKAIPMSGTVHNYWANNPAEDFAFRLAQQNGFTGEN
DDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVV
PKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTR
LVPVDVRTVSSEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFW
HGFNRTFNARLTYAKAPTYYYRFDFDSPNFNFYRAKFCGDKIKTGVAHAD
DLSYLFRNAGSWKLDKTSAEYRTIERMIGIWTAFAATSNPNCPEIGHLEW
KPSTKNDPKRVINISSDVTIIDLPEYEKLQIWDNLYKPNQLI


References
    Title: Functional fat body proteomics and gene targeting reveal in vivo functions of Drosophila melanogaster a-Esterase-7
    Birner-Gruenberger R, Bickmeyer I, Lange J, Hehlert P, Hermetter A, Kollroser M, Rechberger GN, Kuhnlein RP
    Ref: Insect Biochemistry & Molecular Biology, 42:220, 2012 : PubMed

            

    Title: Duplication and divergence of the genes of the alpha-esterase cluster of Drosophila melanogaster
    Robin C, Russell RJ, Medveczky KM, Oakeshott JG
    Ref: Journal of Molecular Evolution, 43:241, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer