drome-lip3

 
Drosophila melanogaster (Fruit fly) lipase 3. LIP3

Relationship
Block X
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: Y14367, AE003699, BT023252
3 UniProt : O46108, Q4V3V4, C8VV13
1 Ncbi-nid : 2894441
1 Ncbi-pid : 2894442
3 UniProtTrembl : O46108, Q4V3V4, C8VV13
3 Interpro : O46108, Q4V3V4, C8VV13
3 Prodom : O46108, Q4V3V4, C8VV13
3 Pfam : O46108, Q4V3V4, C8VV13
3 PIRSF : O46108, Q4V3V4, C8VV13
3 SUPERFAM : O46108, Q4V3V4, C8VV13
3 QuickSwissBlast : O46108, Q4V3V4, C8VV13
1 FlyBase : 0023495
 
Sequence
Graphical view for this peptide sequence: drome-lip3
Colored MSA for Acidic_Lipase (raw)
MTRGALKVTILLVGLGLVLAGSRPISDCGERIEDDGYPMERHEVVTSDNY
ILTMHRIPYSPKTGESSNRPVAFLMHGMLSSSSDWVLMGPERSLAYMLAD
AGYDVWMGNARGNTYSKAHKYWPTYWQIFWNFSWNEIGMYDVPAMIDYVL
AKTGQQQVQYVGHSQGTTVYLVMVSERPEYNDKIKSAHLLGPAAYMGNMK
SPLTRAFAPILGQPNAIVEVCGSMEFMPSNKFKQDLGIEMCQATSPYADM
CANEIFLIGGYDTEQLDYELLEHIKATSPAGASVNQNLHFCQEYNSGKFR
KFDYTALRNPYEYGSYFPPDYKLKNAKAPVLLYYGANDWMCDVSDVRKLR
DELPNMALDYLVPFEKWAHLDFIWGTEARKYVYDEVLKQMQSYE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRGALKVTILLVGLGLVLAGSRPISDCGERIEDDGYPMERHEVVTSDNY
ILTMHRIPYSPKTGESSNRPVAFLMHGMLSSSSDWVLMGPERSLAYMLAD
AGYDVWMGNARGNTYSKAHKYWPTYWQIFWNFSWNEIGMYDVPAMIDYVL
AKTGQQQVQYVGHSQGTTVYLVMVSERPEYNDKIKSAHLLGPAAYMGNMK
SPLTRAFAPILGQPNAIVEVCGSMEFMPSNKFKQDLGIEMCQATSPYADM
CANEIFLIGGYDTEQLDYELLEHIKATSPAGASVNQNLHFCQEYNSGKFR
KFDYTALRNPYEYGSYFPPDYKLKNAKAPVLLYYGANDWMCDVSDVRKLR
DELPNMALDYLVPFEKWAHLDFIWGTEARKYVYDEVLKQMQSYE

Graphical view for this nucleotide DNA sequence (1248 bp): drome-lip3



References
1 more
    Title: Improving on nature's shortcomings: evolving a lipase for increased lipolytic activity, expression and thermostability
    Alfaro-Chavez AL, Liu JW, Porter JL, Goldman A, Ollis DL
    Ref: Protein Engineering Des Sel, 32:13, 2019 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            

    Title: The Drosophila melanogaster lipase homologs: a gene family with tissue and developmental specific expression
    Pistillo D, Manzi A, Tino A, Boyl PP, Graziani F, Malva C
    Ref: Journal of Molecular Biology, 276:877, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer