Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drops-q29kr1

Drosophila pseudoobscura pseudoobscura (Fruit fly) GA14329

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Drosophila pseudoobscura pseudoobscura
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > obscura group: N E > pseudoobscura subgroup: N E > Drosophila pseudoobscura: N E > Drosophila pseudoobscura pseudoobscura: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CH379061
1 UniProt : Q29KR1
1 UniProt : Q29KR1
1 Interpro : Q29KR1
1 Pfam : Q29KR1
1 PIRSF : Q29KR1
1 SUPERFAM : Q29KR1
Sequence
Graphical view for this peptide sequence: drops-q29kr1
Colored MSA for Acidic_Lipase (raw)
MTEIGWIIVAPVMFITCVQINTASQSEPHYRWTTLDWLEAHNVSHELYNV
TTADGYQLQLQRLPRPGARTVLLVHGLLGSSLGWVCLGPDKSLAFQLHQL
QYDVWLANLRGASPYGRHHLELTDVMADFWRFSFHEHGTYDLPAIIDRVA
EVTGGEQESSGADKEEPPRQVLLIGHSQAFNAFLVLCSMHPRFNQRIQLM
QALAPLARLHGQVRFDSAQVRSLMKFVKKRQKSNKFEIFPPGYFRKRCQS
KQDQCEYYTKRLAGSAQSNKRLLDAFNYEYLLQGGSAREIQHLQQIWKSG
DFIAYDYGPIQNMQVYNGVEALRYNLSQISVPTILYFGETDAIATPEGVH
GIYARMMSSVRSVRRIESPKFNHFDFLVSSEVKTLVNDKLIESMEKFLEG
KLSYIIE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTEIGWIIVAPVMFITCVQINTASQSEPHYRWTTLDWLEAHNVSHELYNV
TTADGYQLQLQRLPRPGARTVLLVHGLLGSSLGWVCLGPDKSLAFQLHQL
QYDVWLANLRGASPYGRHHLELTDVMADFWRFSFHEHGTYDLPAIIDRVA
EVTGGEQESSGADKEEPPRQVLLIGHSQAFNAFLVLCSMHPRFNQRIQLM
QALAPLARLHGQVRFDSAQVRSLMKFVKKRQKSNKFEIFPPGYFRKRCQS
KQDQCEYYTKRLAGSAQSNKRLLDAFNYEYLLQGGSAREIQHLQQIWKSG
DFIAYDYGPIQNMQVYNGVEALRYNLSQISVPTILYFGETDAIATPEGVH
GIYARMMSSVRSVRRIESPKFNHFDFLVSSEVKTLVNDKLIESMEKFLEG
KLSYIIE


Reference
    Title: Comparative genome sequencing of Drosophila pseudoobscura: chromosomal, gene, and cis-element evolution
    Richards S, Liu Y, Bettencourt BR, Hradecky P, Letovsky S, Nielsen R, Thornton K, Hubisz MJ, Chen R and Gibbs RA <42 more author(s)>
    Ref: Genome Res, 15:1, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer