Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: droya-b4p0r7

Drosophila yakuba (Fruit fly) GE13495

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Drosophila yakuba
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila yakuba: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CM000157
1 UniProt : B4P0R7
1 UniProt : B4P0R7
1 Interpro : B4P0R7
1 Prodom : B4P0R7
1 Pfam : B4P0R7
1 PIRSF : B4P0R7
1 SUPERFAM : B4P0R7
Sequence
Graphical view for this peptide sequence: droya-b4p0r7
Colored MSA for Acidic_Lipase (raw)
MPQAIWFLLVLGCCRVLGGYMEDNYPPSVIEDAHLNTIQLLEKYKHPAET
HQMTTDDKYILTLHRIPRPGAKPVLLVHGLEDSSSTWISMGPESGLGYFL
YANGYDVWMGNVRGNRYSKGHVKLNSNTDKSYWSFSWHEIGMYDLPAMID
GVLQKTGYQKLSYFGHSQGTTSFFVMASSRPEYNAKIHLMSALAPVAFMK
HMKAPLMRMARMGMNMFSENFEMFPHSEIFLNHCLSSAAMLRTCVRFYWQ
IVGMNREEQNMTMFPVVLGHLPSGANLKQAHHYLQLQKSDRFCQYEYEPK
ENQKLYGRSTPPDYRLERISAPVALYYGSNDYLAAVEDVQRLAKVLPNVV
ENHLYRKWNHMDMLWGISARRSIQPRILQVMQYWEAGGVAKDATTGSPVE
EDVPQPTTVTLIEAGKPDEEEEVGSGQGNEENEAHVEGTEQLEATTSPTG
EL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPQAIWFLLVLGCCRVLGGYMEDNYPPSVIEDAHLNTIQLLEKYKHPAET
HQMTTDDKYILTLHRIPRPGAKPVLLVHGLEDSSSTWISMGPESGLGYFL
YANGYDVWMGNVRGNRYSKGHVKLNSNTDKSYWSFSWHEIGMYDLPAMID
GVLQKTGYQKLSYFGHSQGTTSFFVMASSRPEYNAKIHLMSALAPVAFMK
HMKAPLMRMARMGMNMFSENFEMFPHSEIFLNHCLSSAAMLRTCVRFYWQ
IVGMNREEQNMTMFPVVLGHLPSGANLKQAHHYLQLQKSDRFCQYEYEPK
ENQKLYGRSTPPDYRLERISAPVALYYGSNDYLAAVEDVQRLAKVLPNVV
ENHLYRKWNHMDMLWGISARRSIQPRILQVMQYWEAGGVAKDATTGSPVE
EDVPQPTTVTLIEAGKPDEEEEVGSGQGNEENEAHVEGTEQLEATTSPTG
EL


Reference
    Title: Evolution of genes and genomes on the Drosophila phylogeny
    Clark AG, Eisen MB, Smith DR, Bergman CM, Oliver B, Markow TA, Kaufman TC, Kellis M, Gelbart W and MacCallum I <405 more author(s)>
    Ref: Nature, 450:203, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer