Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ecoli-C2451

Escherichia coli Putative thioesterase Possible Oleoyl-[acyl-carrier-protein] hydrolase, putative thioesterase

Comment
Other strains: Escherichia coli ( strains O6; UTI89 / UPEC; NC101; 3_2_53FAA; F11; O6:K15:H31/536/UPEC; O18:K1:H7/IHE3034/ExPEC; MS 200-1; MS 185-1; MS 45-1; 83972) putative thioesterase


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Escherichia coli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Escherichia: N E > Escherichia coli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5UGZ: Crystal structure of ClbQ from the colibactin NRPS/PKS pathway
No kinetic





No Substrate
No inhibitor
>3 Genbank links 9 more: AE016762, ADTO01000058, ACGN01000094
1 UniProt : Q1RAD9
1 Structure : 5UGZ
2 UniProt : Q0P7K7, Q1RAD9
2 Interpro : Q0P7K7, Q1RAD9
2 Prodom : Q0P7K7, Q1RAD9
2 Pfam : Q0P7K7, Q1RAD9
2 PIRSF : Q0P7K7, Q1RAD9
2 SUPERFAM : Q0P7K7, Q1RAD9
Sequence
Graphical view for this peptide sequence: ecoli-C2451
Colored MSA for Thioesterase (raw)
MSNISLYCLPYSGGSAAMYYKWRSVLSDNITLRPLEPAGRGTRIRQPLCL
TMVDAVADLYQQFVKHYTGGDYAIFGHSLGGIMAFELVHYILDHGHDMPC
ALFFSGCRPPDRASHEVILHTLPDQAFMEEIVKLGGTPVDVFRNKELMTI
FTPIIKNDYRLYEQYVFQAKARTLTCPIVLFHGDADNLVMQDELLAWEKF
TTRKTRTIIFPAADHFFVDKHFEQVVGYVNQTIESLEIVG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNISLYCLPYSGGSAAMYYKWRSVLSDNITLRPLEPAGRGTRIRQPLCL
TMVDAVADLYQQFVKHYTGGDYAIFGHSLGGIMAFELVHYILDHGHDMPC
ALFFSGCRPPDRASHEVILHTLPDQAFMEEIVKLGGTPVDVFRNKELMTI
FTPIIKNDYRLYEQYVFQAKARTLTCPIVLFHGDADNLVMQDELLAWEKF
TTRKTRTIIFPAADHFFVDKHFEQVVGYVNQTIESLEIVG


References
3 more
    Title: Identification of protective and broadly conserved vaccine antigens from the genome of extraintestinal pathogenic Escherichia coli
    Moriel DG, Bertoldi I, Spagnuolo A, Marchi S, Rosini R, Nesta B, Pastorello I, Corea VA, Torricelli G and Serino L <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 107:9072, 2010 : PubMed

            

    Title: Role of pathogenicity island-associated integrases in the genome plasticity of uropathogenic Escherichia coli strain 536
    Hochhut B, Wilde C, Balling G, Middendorf B, Dobrindt U, Brzuszkiewicz E, Gottschalk G, Carniel E, Hacker J
    Ref: Molecular Microbiology, 61:584, 2006 : PubMed

            

    Title: Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli
    Welch RA, Burland V, Plunkett G, 3rd, Redford P, Roesch P, Rasko D, Buckles EL, Liou SR, Boutin A and Blattner FR <9 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:17020, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer