Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ecoli-ypt1

Escherichia coli yiea YPT1 YPT2 hypothetical 31.7 kda protein in trax-fino intergenic region encoded on plasmid

Comment
In some bacteria a gene fusion event leads to expression of a CMD with a hydrolase involved in the same pathway In these bifunctional proteins (e.g. O67982) CMD represents the C-terminal domain, Abhydrolase_1 represents the N-terminal domain wb0004. An identical sequence found in Plasmid R100 Trembl Q7AK60 yiea protein. Q27TG2_ECOLI quite different. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains.


Relationship
Family|Xaa-Pro-like_dom
Block| X
Position in NCBI Life Tree|Escherichia coli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Escherichia: N E > Escherichia coli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 11 more: M38048, AY458016, AY214164
>3 UniProt links 13 more: P29368, Q0H0A9, D7XWZ9
>3 UniProt links 15 more: Q0H0A9, D7XWZ9, A7ZGM8
>3 Interpro links 15 more: Q0H0A9, D7XWZ9, A7ZGM8
>3 Prodom links 15 more: Q0H0A9, D7XWZ9, A7ZGM8
>3 Pfam links 15 more: Q0H0A9, D7XWZ9, A7ZGM8
>3 PIRSF links 15 more: Q0H0A9, D7XWZ9, A7ZGM8
>3 SUPERFAM links 15 more: Q0H0A9, D7XWZ9, A7ZGM8
Sequence
Graphical view for this peptide sequence: ecoli-ypt1
Colored MSA for Xaa-Pro-like_dom (raw)
MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPCFANAFT
EAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQR
IGLWGTSLGGGHVFSARAQDQRVKCIVSQLAFADGDVLVTGEMNESERAS
FLSTLNKMAEKKKNTGKEMFVGVTRVLSDNESKVFFEKVKGQYPEMDIKI
PFLTVMETLQYKPAESAAKVQCPVLIVIAGQDSVNPPEQGKALYDAVASG
TKELYEEADACHYDIYEGAFFERVAAVQTQWFKKHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPCFANAFT
EAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQR
IGLWGTSLGGGHVFSARAQDQRVKCIVSQLAFADGDVLVTGEMNESERAS
FLSTLNKMAEKKKNTGKEMFVGVTRVLSDNESKVFFEKVKGQYPEMDIKI
PFLTVMETLQYKPAESAAKVQCPVLIVIAGQDSVNPPEQGKALYDAVASG
TKELYEEADACHYDIYEGAFFERVAAVQTQWFKKHL


References
35 more
    Title: Comparative genomics reveal the mechanism of the parallel evolution of O157 and non-O157 enterohemorrhagic Escherichia coli
    Ogura Y, Ooka T, Iguchi A, Toh H, Asadulghani M, Oshima K, Kodama T, Abe H, Nakayama K and Hayashi T <3 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 106:17939, 2009 : PubMed

            

    Title: The pangenome structure of Escherichia coli: comparative genomic analysis of E. coli commensal and pathogenic isolates
    Rasko DA, Rosovitz MJ, Myers GS, Mongodin EF, Fricke WF, Gajer P, Crabtree J, Sebaihia M, Thomson NR and Ravel J <3 more author(s)>
    Ref: Journal of Bacteriology, 190:6881, 2008 : PubMed

            

    Title: Nucleotide sequence analysis of the enteropathogenic Escherichia coli adherence factor plasmid pMAR7
    Brinkley C, Burland V, Keller R, Rose DJ, Boutin AT, Klink SA, Blattner FR, Kaper JB
    Ref: Infect Immun, 74:5408, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer