Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: eleel-ACHE

Electrophorus electricus (Electric eel) (Gymnotus electricus) acetylcholinesterase

Comment
Cterminus T peptide


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Electrophorus electricus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Otomorpha: N E > Ostariophysi: N E > Otophysi: N E > Characiphysae: N E > Gymnotiformes: N E > Gymnotoidei: N E > Gymnotidae: N E > Electrophorus: N E > Electrophorus electricus: N E


Molecular evidence
Database
6 mutations: Table (e.g. : E463R, L280H, L460V ... more)
3 structures: 1C2B, 1C2O, 1EEA
Kinetic: eleel-ACHE





4 substrates (e.g. : Acetylazacholine, Acetylcholine, Acetylthiocholine... more)
1 inhbitor:
Phenylacetone
1 Genbank : AF030422
1 UniProt : O42275
1 Ncbi-nid : 2613035
1 Ncbi-pid : 2613036
3 Structure : 1EEA, 1C2B, 1C2O
1 UniProt : O42275
1 Interpro : O42275
1 Prodom : O42275
1 Pfam : O42275
1 PIRSF : O42275
1 SUPERFAM : O42275
Sequence
Graphical view for this peptide sequence: eleel-ACHE
Colored MSA for ACHE (raw)
MKILDALLFPVIFIMFFIHLSIAQTDPELTIMTRLGQVQGTRLPVPDRSH
VIAFLGIPFAEPPLGKMRFKPPEPKKPWNDVFDARDYPSACYQYVDTSYP
GFSGTEMWNPNRMMSEDCLYLNVWVPATPRPHNLTVMVWIYGGGFYSGSS
SLDVYDGRYLAHSEKVVVVSMNYRVSAFGFLALNGSAEAPGNVGLLDQRL
ALQWVQDNIHFFGGNPKQVTIFGESAGAASVGMHLLSPDSRPKFTRAILQ
SGVPNGPWRTVSFDEARRRAIKLGRLVGCPDGNDTDLIDCLRSKQPQDLI
DQEWLVLPFSGLFRFSFVPVIDGVVFPDTPEAMLNSGNFKDTQILLGVNQ
NEGSYFLIYGAPGFSKDNESLITREDFLQGVKMSVPHANEIGLEAVILQY
TDWMDEDNPIKNREAMDDIVGDHNVVCPLQHFAKMYAQYSILQGQTGTAS
QGNLGWGNSGSASNSGNSQVSVYLYMFDHRASNLVWPEWMGVIHGYEIEF
VFGLPLEKRLNYTLEEEKLSRRMMKYWANFARTGNPNINVDGSIDSRRRW
PVFTSTEQKHVGLNTDSLKVHKGLKSQFCALWNRFLPRLLNVTENIDDAE
RQWKAEFHRWSSYMMHWKNQFDHYSKQERCTNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKILDALLFPVIFIMFFIHLSIAQTDPELTIMTRLGQVQGTRLPVPDRSH
VIAFLGIPFAEPPLGKMRFKPPEPKKPWNDVFDARDYPSACYQYVDTSYP
GFSGTEMWNPNRMMSEDCLYLNVWVPATPRPHNLTVMVWIYGGGFYSGSS
SLDVYDGRYLAHSEKVVVVSMNYRVSAFGFLALNGSAEAPGNVGLLDQRL
ALQWVQDNIHFFGGNPKQVTIFGESAGAASVGMHLLSPDSRPKFTRAILQ
SGVPNGPWRTVSFDEARRRAIKLGRLVGCPDGNDTDLIDCLRSKQPQDLI
DQEWLVLPFSGLFRFSFVPVIDGVVFPDTPEAMLNSGNFKDTQILLGVNQ
NEGSYFLIYGAPGFSKDNESLITREDFLQGVKMSVPHANEIGLEAVILQY
TDWMDEDNPIKNREAMDDIVGDHNVVCPLQHFAKMYAQYSILQGQTGTAS
QGNLGWGNSGSASNSGNSQVSVYLYMFDHRASNLVWPEWMGVIHGYEIEF
VFGLPLEKRLNYTLEEEKLSRRMMKYWANFARTGNPNINVDGSIDSRRRW
PVFTSTEQKHVGLNTDSLKVHKGLKSQFCALWNRFLPRLLNVTENIDDAE
RQWKAEFHRWSSYMMHWKNQFDHYSKQERCTNL


References
    Title: Conformational flexibility of the acetylcholinesterase tetramer suggested by x-ray crystallography
    Bourne Y, Grassi J, Bougis PE, Marchot P
    Ref: Journal of Biological Chemistry, 274:30370, 1999 : PubMed

            

    Title: Quaternary Structure of Tetrameric Acetylcholinesterase
    Raves ML, Giles K, Schrag JD, Schmid MF, Phillips JN, Jr., Chiu W, Howard AJ, Silman I, Sussman JL
    Ref: In: Structure and Function of Cholinesterases and Related Proteins - Proceedings of Sixth International Meeting on Cholinesterases, (Doctor, B.P., Taylor, P., Quinn, D.M., Rotundo, R.L., Gentry, M.K. Eds) Plenum Publishing Corp.:351, 1998 : PubMed

            

    Title: Cloning and expression of acetylcholinesterase from Electrophorus. Splicing pattern of the 3' exons in vivo and in transfected mammalian cells
    Simon S, Massoulie J
    Ref: Journal of Biological Chemistry, 272:33045, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer