Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: emend-q7z8l7

Emericella nidulans (Aspergillus nidulans). Putative histone deacetylase Arb2 domain

Comment
Other strains: Aspergillus Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Emericella nidulans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus nidulans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF306859, XP_681311
1 UniProt : Q7Z8L7
3 UniProt : Q7Z8L7, C8V606, Q5AUI8
3 Interpro : Q7Z8L7, C8V606, Q5AUI8
3 Prodom : Q7Z8L7, C8V606, Q5AUI8
3 Pfam : Q7Z8L7, C8V606, Q5AUI8
3 PIRSF : Q7Z8L7, C8V606, Q5AUI8
3 SUPERFAM : Q7Z8L7, C8V606, Q5AUI8
Sequence
Graphical view for this peptide sequence: emend-q7z8l7
Colored MSA for Arb2_domain (raw)
RLHDIIRAYQAKQLYDNYKLTSLYIYRTAISKSFENQVLASPNYNQATPL
IVIFHDPPEIMGLPHPLTNNLEAHNCWLADVMKDYVQWAVGKGYAVIDVN
IPKHVTTEPSSGRFEEEDENRPTATEELAGYLWDNYIDPNEATEIFLVGI
GNAFYGVANLLINRETLYQRVNGVISFVAKDPVRAVASHTQVWLSRWYRD
NSLVFVSKAHGVWKSDRKATKRYGKLIQSSREGLSDMLMHHKDEVFQWIE
DRIEPESEETEEEKPVKRSPTKAAPKAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RLHDIIRAYQAKQLYDNYKLTSLYIYRTAISKSFENQVLASPNYNQATPL
IVIFHDPPEIMGLPHPLTNNLEAHNCWLADVMKDYVQWAVGKGYAVIDVN
IPKHVTTEPSSGRFEEEDENRPTATEELAGYLWDNYIDPNEATEIFLVGI
GNAFYGVANLLINRETLYQRVNGVISFVAKDPVRAVASHTQVWLSRWYRD
NSLVFVSKAHGVWKSDRKATKRYGKLIQSSREGLSDMLMHHKDEVFQWIE
DRIEPESEETEEEKPVKRSPTKAAPKAA


Reference
    Title: Histone deacetylases in fungi: novel members, new facts
    Trojer P, Brandtner EM, Brosch G, Loidl P, Galehr J, Linzmaier R, Haas H, Mair K, Tribus M, Graessle S
    Ref: Nucleic Acids Research, 31:3971, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer