Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: emeni-q5b2c1

Aspergillus nidulans FGSC A4; Emericella nidulans Cut1 ANCUT1 hypothetical protein AnCut

Comment
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) Best pNP substrate pNP-C8 Paranitrophenyl-octanoate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Aspergillus nidulans FGSC A4
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus nidulans: N E > Aspergillus nidulans FGSC A4: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Cutin, Paranitrophenyl-octanoate
No inhibitor
2 Genbank : AACD01000093, EAA62469
1 UniProt : Q5B2C1
1 UniProt : Q5B2C1
1 Interpro : Q5B2C1
1 Prodom : Q5B2C1
1 Pfam : Q5B2C1
1 PIRSF : Q5B2C1
1 SUPERFAM : Q5B2C1
Sequence
Graphical view for this peptide sequence: emeni-q5b2c1
Colored MSA for Cutinase (raw)
MKLQLHLALSLLAAIVAANPIRLDQRQITGNELRDGSCHDVTFIFARGST
ELGYLGSTVGPATCNVLKLRKPGQVACQGVAPAYIADLASNFLPQGTNQI
AINEAKSLFELAASKCPNTKIVAGGYSQGAAVMHAAISTLSSTVQDQIKG
VVLFGDTRNKQDGGRIPNFPTDKTKIICAFGDLVCEGTLVITAAHLSYID
DVPDAADFLVGKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLQLHLALSLLAAIVAANPIRLDQRQITGNELRDGSCHDVTFIFARGST
ELGYLGSTVGPATCNVLKLRKPGQVACQGVAPAYIADLASNFLPQGTNQI
AINEAKSLFELAASKCPNTKIVAGGYSQGAAVMHAAISTLSSTVQDQIKG
VVLFGDTRNKQDGGRIPNFPTDKTKIICAFGDLVCEGTLVITAAHLSYID
DVPDAADFLVGKL


References
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: Regulation of the cutinases expressed by Aspergillus nidulans and evaluation of their role in cutin degradation
    Bermudez-Garcia E, Pena-Montes C, Martins I, Pais J, Pereira CS, Sanchez S, Farres A
    Ref: Applied Microbiology & Biotechnology, 103:3863, 2019 : PubMed

            

    Title: Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae
    Galagan JE, Calvo SE, Cuomo C, Ma LJ, Wortman JR, Batzoglou S, Lee SI, Basturkmen M, Spevak CC and Birren BW <40 more author(s)>
    Ref: Nature, 438:1105, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer