Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: entas-cinB

Enterobacter asburiae Alpha/beta hydrolase cinB

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Enterobacter asburiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Enterobacter: N E > Enterobacter cloacae complex: N E > Enterobacter asburiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6KMO: Crystal structure of a novel esterase CinB from Enterobacter asburiae
No kinetic





No Substrate
No inhibitor
1 Genbank : AMX08231
1 UniProt : A0A143I3F8
1 Structure : 6KMO
1 UniProt : A0A143I3F8
1 Interpro : A0A143I3F8
1 Prodom : A0A143I3F8
1 Pfam : A0A143I3F8
1 PIRSF : A0A143I3F8
1 SUPERFAM : A0A143I3F8
Sequence
Graphical view for this peptide sequence: entas-cinB
Colored MSA for Hormone-sensitive_lipase_like (raw)
MKTLTAILISSVFASAAASAQTANTPTPTAGVQAFLNVLNSGKGKPMEQM
TPQEARQVLIGAQQGAKLPPAQVSEKTIQVNGQAIKLKIVKPENASGTLP
AFMFFHGGGWVLGDFPTHERLIRDLVRASGAAAVYVDYTPSPEAHFPVAI
NQAYEATKWVAEHGQEIGVDGSRLGLVGNSVGGNMVASVALQAKQFNGPK
IRYNVMLWPVTDANFDTASYNQFENGYFLSKNMMKWFWDNYTTSAADRNN
ILASPLRASTAQLKGFPETLIQTAELDVLRDEGEAFGRKLDAAGVPVTVT
RYNGMIHDYGLLNPLSQEPTVKVALEQAGAALHEHLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTLTAILISSVFASAAASAQTANTPTPTAGVQAFLNVLNSGKGKPMEQM
TPQEARQVLIGAQQGAKLPPAQVSEKTIQVNGQAIKLKIVKPENASGTLP
AFMFFHGGGWVLGDFPTHERLIRDLVRASGAAAVYVDYTPSPEAHFPVAI
NQAYEATKWVAEHGQEIGVDGSRLGLVGNSVGGNMVASVALQAKQFNGPK
IRYNVMLWPVTDANFDTASYNQFENGYFLSKNMMKWFWDNYTTSAADRNN
ILASPLRASTAQLKGFPETLIQTAELDVLRDEGEAFGRKLDAAGVPVTVT
RYNGMIHDYGLLNPLSQEPTVKVALEQAGAALHEHLK


Reference
    Title: Structural and functional analyses of the lipase CinB from Enterobacter asburiae
    Shang F, Lan J, Liu W, Chen Y, Wang L, Zhao J, Chen J, Gao P, Ha NC and Xu Y <2 more author(s)>
    Ref: Biochemical & Biophysical Research Communications, 519:274, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer