Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: entcl-PRBA

Enterobacter cloacae, Serratia liquefaciens; Klebsiella sp., paraben-hydrolyzing esterase precursor

Comment
Other strains: Enterobacter cloacae, Serratia liquefaciens ATCC 27592; Klebsiella sp. LTGPAF-6F strange high homology in two species?


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Enterobacter cloacae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Enterobacter: N E > Enterobacter cloacae complex: N E > Enterobacter cloacae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
>3 Genbank links 1 more: AY077721, CP006252, WP_048758884
2 UniProt : Q8RLU0, A0A1D8K380
2 Interpro : Q8RLU0, A0A1D8K380
2 Prodom : Q8RLU0, A0A1D8K380
2 Pfam : Q8RLU0, A0A1D8K380
2 PIRSF : Q8RLU0, A0A1D8K380
2 SUPERFAM : Q8RLU0, A0A1D8K380
Sequence
Graphical view for this peptide sequence: entcl-PRBA
Colored MSA for Carb_B_Bacteria (raw)
MELHTRNKRRILTLAALAGLSITAMSANAFAQELSPVVQMSKGTIEGVKN
DGYLQFKGIPYAKAPVGSLRWMPPVEEEKWSGTLKANHFANTCATKLTLG
GFGPVSAAEDCLYLNVYTPAVLPENNRKLPVMVWIPGGGLSSGSGNEYDA
SKLVSKNVIVVTMNYRLGMFGYFSHPALNHEGHKAINYGTLDQQAALKWV
NKNIQSFGGDNHNVTLFGESAGGHSVLAQMASPGAKGLFNRAIVSSGSYS
LKQPTVAEATKIGELVAKNVGCSEGTEEKMAECLRAVPTETILDKGVNYM
TTAQVVTDGEVMPESLEAAFSSGRYNVVPIINGFNTNEGTFFAAMMELDS
GKPIDNIGFYEGLKAFFGEGDANTLIKRAAIPAKQVNLGQDYADFFGRAK
FICRTPMMNNLLAKNTPVYSYEFADKTAPQFAKPVSFPYAAAHTSDLQYI
FRDFHGTTGELHKLNPAQEKLSILMVDYWTNFAKTGNPNAKGLPVWGVYH
PQTESTLYLHTQNTKMIEGISKTFNCDEFAGVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELHTRNKRRILTLAALAGLSITAMSANAFAQELSPVVQMSKGTIEGVKN
DGYLQFKGIPYAKAPVGSLRWMPPVEEEKWSGTLKANHFANTCATKLTLG
GFGPVSAAEDCLYLNVYTPAVLPENNRKLPVMVWIPGGGLSSGSGNEYDA
SKLVSKNVIVVTMNYRLGMFGYFSHPALNHEGHKAINYGTLDQQAALKWV
NKNIQSFGGDNHNVTLFGESAGGHSVLAQMASPGAKGLFNRAIVSSGSYS
LKQPTVAEATKIGELVAKNVGCSEGTEEKMAECLRAVPTETILDKGVNYM
TTAQVVTDGEVMPESLEAAFSSGRYNVVPIINGFNTNEGTFFAAMMELDS
GKPIDNIGFYEGLKAFFGEGDANTLIKRAAIPAKQVNLGQDYADFFGRAK
FICRTPMMNNLLAKNTPVYSYEFADKTAPQFAKPVSFPYAAAHTSDLQYI
FRDFHGTTGELHKLNPAQEKLSILMVDYWTNFAKTGNPNAKGLPVWGVYH
PQTESTLYLHTQNTKMIEGISKTFNCDEFAGVL


References
    Title: Complete Genome Sequence of Serratia liquefaciens Strain ATCC 27592
    Nicholson WL, Leonard MT, Fajardo-Cavazos P, Panayotova N, Farmerie WG, Triplett EW, Schuerger AC
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Purification and characterization of PrbA, a new esterase from Enterobacter cloacae hydrolyzing the esters of 4-hydroxybenzoic acid (parabens)
    Valkova N, Lepine F, Labrie L, Dupont M, Beaudet R
    Ref: Journal of Biological Chemistry, 278:12779, 2003 : PubMed

            

    Title: prbA, a gene coding for an esterase hydrolyzing parabens in enterobacter cloacae and Enterobacter gergoviae strains
    Valkova N, Lepine F, Bollet C, Dupont M, Villemur R
    Ref: Journal of Bacteriology, 184:5011, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer