Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: erisi-a0a1l5jht6

Eriocheir sinensis (Chinese mitten crab) Carboxylic ester hydrolase Juvenile hormone esterase-like carboxylesterase 1

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Eriocheir sinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Multicrustacea: N E > Malacostraca: N E > Eumalacostraca: N E > Eucarida: N E > Decapoda: N E > Pleocyemata: N E > Brachyura: N E > Eubrachyura: N E > Thoracotremata: N E > Grapsoidea: N E > Varunidae: N E > Eriocheir: N E > Eriocheir sinensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Methyl-farnesoate
No inhibitor
2 Genbank : APO14259, KX092452
1 UniProt : A0A1L5JHT6
1 UniProt : A0A1L5JHT6
1 Interpro : A0A1L5JHT6
1 Prodom : A0A1L5JHT6
1 Pfam : A0A1L5JHT6
1 PIRSF : A0A1L5JHT6
1 SUPERFAM : A0A1L5JHT6
Sequence
Graphical view for this peptide sequence: erisi-a0a1l5jht6
Colored MSA for Carb_B_Arthropoda (raw)
MRLIATAVVVVVLVAVKVVAAAGEATATEVPLVETEGGRVSGILEESLKG
REFYSFYGIPFAQPPVGKLRFKDPAAPSPWEGTRNASVPPAACPQYDFSG
MMSEPFAGQEDCLYLNVFTPKTKEEGGLPVMVWIHGGAFFSGSATEYRPH
VLLNHDVVLVVVQYRLGVLGFLSTEDSVMPGNLGLKDQTMALQWVQRNIH
RFGGDKTRVTIFGESAGGASVHYQMLTPKTEGLFSRAILQSGAALCPWSV
NTNPRKAALRVASIVGCPADQGSHALLECLQGLDAVTIVPLFSNFFEWNM
LPFAFTPWVDGEYLPEQPEQLALKGRYAQVDIMAGVTRDEGALFVIAPLR
EKKVMEQIQNNFSVAGPASLALSGQCDDPVAVARQVYLHYSGTTHVTEAH
AESLNRMYGDRHFAVCHDLTTALHAAHHHPTKKTFRYELQHRGQFSLLNF
MCPSCSQDWVCHGDDLFYLFPGGPIPAPLSSEDLQRPDDLAVRDIIVALW
TNFAITGNPTPDDSLGFKWEPSTADSLHYLSLTPSPSMQPDDRKDARKFH
NSLPTTLNMILHPDLVEGGASEPQDDGYDAKTEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLIATAVVVVVLVAVKVVAAAGEATATEVPLVETEGGRVSGILEESLKG
REFYSFYGIPFAQPPVGKLRFKDPAAPSPWEGTRNASVPPAACPQYDFSG
MMSEPFAGQEDCLYLNVFTPKTKEEGGLPVMVWIHGGAFFSGSATEYRPH
VLLNHDVVLVVVQYRLGVLGFLSTEDSVMPGNLGLKDQTMALQWVQRNIH
RFGGDKTRVTIFGESAGGASVHYQMLTPKTEGLFSRAILQSGAALCPWSV
NTNPRKAALRVASIVGCPADQGSHALLECLQGLDAVTIVPLFSNFFEWNM
LPFAFTPWVDGEYLPEQPEQLALKGRYAQVDIMAGVTRDEGALFVIAPLR
EKKVMEQIQNNFSVAGPASLALSGQCDDPVAVARQVYLHYSGTTHVTEAH
AESLNRMYGDRHFAVCHDLTTALHAAHHHPTKKTFRYELQHRGQFSLLNF
MCPSCSQDWVCHGDDLFYLFPGGPIPAPLSSEDLQRPDDLAVRDIIVALW
TNFAITGNPTPDDSLGFKWEPSTADSLHYLSLTPSPSMQPDDRKDARKFH
NSLPTTLNMILHPDLVEGGASEPQDDGYDAKTEL


Reference
    Title: Molecular cloning, characterization and expression analysis of two juvenile hormone esterase-like carboxylesterase cDNAs in Chinese mitten crab, Eriocheir sinensis
    Xu Y, Zhao M, Deng Y, Yang Y, Li X, Lu Q, Ge J, Pan J, Xu Z
    Ref: Comparative Biochemistry & Physiology B Biochem Mol Biol, 205:46, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer