Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: erygu-a0a022qsc9

Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). Uncharacterized protein

Relationship
Family|Maspardin-ACP33-SPG21_like
Block| X
Position in NCBI Life Tree|Erythranthe guttata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Lamiales: N E > Phrymaceae: N E > Erythranthe: N E > Erythranthe guttata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KI631057
1 UniProt : A0A022QSC9
1 UniProt : A0A022QSC9
1 Interpro : A0A022QSC9
1 Prodom : A0A022QSC9
1 Pfam : A0A022QSC9
1 PIRSF : A0A022QSC9
1 SUPERFAM : A0A022QSC9
Sequence
Graphical view for this peptide sequence: erygu-a0a022qsc9
Colored MSA for Maspardin-ACP33-SPG21_like (raw)
MKGGFSAPGDYVYFKSQVPLHRIPIGSKQWRYYDFGPKVVPPLICLPGIA
GTADVYYKQIMSLSMKGYRVISVDIPRVWNQQEWIQAFEKFLDAIDVHHI
HLYGTSLGGFLAQLFAQHRPRRVRSLVLSNTFLETTSFSAAMPWSPIVGW
TPSFLLKRYVLSGIRDGPHEPFIADSVDFVVAQVETLSKDDLASRLSISV
DAASVGHLMLSDSLITIIDTNDYCATPQELKDQVTERYPGARQASLKSGG
DFPFLSRPDEVNLHLQLHLRRVGVEARQDMVPGIRKDDSGGSSSGQNDKR
GNTDDETPQDDKKDFGGGPTNSNEPPLLPEGSDSDHFENQTLGKSYLSSD
DISGENMVRLIMLPAVLENGIAMLACEAVLNAMCEYAFLNLLRVYLSTLC
VVNLDV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKGGFSAPGDYVYFKSQVPLHRIPIGSKQWRYYDFGPKVVPPLICLPGIA
GTADVYYKQIMSLSMKGYRVISVDIPRVWNQQEWIQAFEKFLDAIDVHHI
HLYGTSLGGFLAQLFAQHRPRRVRSLVLSNTFLETTSFSAAMPWSPIVGW
TPSFLLKRYVLSGIRDGPHEPFIADSVDFVVAQVETLSKDDLASRLSISV
DAASVGHLMLSDSLITIIDTNDYCATPQELKDQVTERYPGARQASLKSGG
DFPFLSRPDEVNLHLQLHLRRVGVEARQDMVPGIRKDDSGGSSSGQNDKR
GNTDDETPQDDKKDFGGGPTNSNEPPLLPEGSDSDHFENQTLGKSYLSSD
DISGENMVRLIMLPAVLENGIAMLACEAVLNAMCEYAFLNLLRVYLSTLC
VVNLDV


Reference
    Title: Fine-scale variation in meiotic recombination in Mimulus inferred from population shotgun sequencing
    Hellsten U, Wright KM, Jenkins J, Shu S, Yuan Y, Wessler SR, Schmutz J, Willis JH, Rokhsar DS
    Ref: Proc Natl Acad Sci U S A, 110:19478, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer