Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: erylo-E53

Erythrobacter longus Hormone-sensitive lipase E53 alkalophilic esterase

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Erythrobacter longus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Erythrobacteraceae: N E > Erythrobacter: N E > Erythrobacter longus: N E


Molecular evidence
Database
No mutation
8 structures (e.g. : 6KEU, 6KF1, 6KF5... more)
No kinetic





1 substrate:
Paranitrophenyl-hexanoate
No inhibitor
2 Genbank : KEO91609, WP_034957919
1 UniProt : A0A074MDU6
>3 Structure links 5 more: 7W8N, 6KF5, 6KEU
1 UniProt : A0A074MDU6
1 Interpro : A0A074MDU6
1 Prodom : A0A074MDU6
1 Pfam : A0A074MDU6
1 PIRSF : A0A074MDU6
1 SUPERFAM : A0A074MDU6
Sequence
Graphical view for this peptide sequence: erylo-E53
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTDTPFIRPDMKAFLEAIAAMAGPTLAEMTLEEARASYVALHGMADRPAR
ELAVIRNLSCPGPAGDIPLRLYDARESREAGPVITFYHGGGFVIGDLDTH
HNLCTEIAALMDLPVVAVDYRLAPEHPFPAAIEDCEAATRWVASSPSELG
RTASGVIPIGDSAGGNATIVVSQLLGAKPADVPVVLQVPIFPLASDAVGS
ASLEAFAEGFVLTKASIEFFDTAYKADRADPRGFPILGDHTAAPPTIVAT
ASLDPIRDSGRDYAKALVEAGRDVVYLEMEGVTHSFTNIRAAVPSTQGDL
ERIIAAMKMMLGTA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDTPFIRPDMKAFLEAIAAMAGPTLAEMTLEEARASYVALHGMADRPAR
ELAVIRNLSCPGPAGDIPLRLYDARESREAGPVITFYHGGGFVIGDLDTH
HNLCTEIAALMDLPVVAVDYRLAPEHPFPAAIEDCEAATRWVASSPSELG
RTASGVIPIGDSAGGNATIVVSQLLGAKPADVPVVLQVPIFPLASDAVGS
ASLEAFAEGFVLTKASIEFFDTAYKADRADPRGFPILGDHTAAPPTIVAT
ASLDPIRDSGRDYAKALVEAGRDVVYLEMEGVTHSFTNIRAAVPSTQGDL
ERIIAAMKMMLGTA


Reference
    Title: Mechanism and Structural Insights Into a Novel Esterase, E53, Isolated From Erythrobacter longus
    Ding Y, Nie L, Yang XC, Li Y, Huo YY, Li Z, Gao Y, Cui HL, Li J, Xu XW
    Ref: Front Microbiol, 12:798194, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer