Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: exiab-k0acl0

Exiguobacterium antarcticum (strain B7).Abhydrolase domain-containing protein

Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Exiguobacterium antarcticum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillales incertae sedis: N E > Bacillales Family XII. Incertae Sedis: N E > Exiguobacterium: N E > Exiguobacterium antarcticum: N E


Molecular evidence
Database
No mutation
1 structure:
5H3H: Esterase (EaEST) from Exiguobacterium antarcticum
No kinetic





No Substrate
No inhibitor
2 Genbank : AFS70572, WP_014970431.1
1 UniProt : K0ACL0
1 Structure : 5H3H
1 UniProt : K0ACL0
1 Interpro : K0ACL0
1 Prodom : K0ACL0
1 Pfam : K0ACL0
1 PIRSF : K0ACL0
1 SUPERFAM : K0ACL0
Sequence
Graphical view for this peptide sequence: exiab-k0acl0
Colored MSA for Haloperoxidase (raw)
MGTFIQAVDGTKIYVEDIGSGQPVVMLHGWPANNNMFEYQKNRLLEEGYR
YIGVDYRGYGKSDAPATGYDYTTMASDINEVIQQLKLTNVTLLGFSMGGG
IALKYLLNHGESNVSKLILAGAAAPVFTQRDGYPYGMTKDEVDALIEDTK
QDRPSMLKGFGEIFFAKEHPEPLQQWFHNLSVDASSHGTIQSAIALRDED
LRDGLPKITVDTLIMHGKKDQVCPFEFAEVMHENIAGSRLEVFEESGHGM
FLDEREKFTETLVSYVKSSQTV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGTFIQAVDGTKIYVEDIGSGQPVVMLHGWPANNNMFEYQKNRLLEEGYR
YIGVDYRGYGKSDAPATGYDYTTMASDINEVIQQLKLTNVTLLGFSMGGG
IALKYLLNHGESNVSKLILAGAAAPVFTQRDGYPYGMTKDEVDALIEDTK
QDRPSMLKGFGEIFFAKEHPEPLQQWFHNLSVDASSHGTIQSAIALRDED
LRDGLPKITVDTLIMHGKKDQVCPFEFAEVMHENIAGSRLEVFEESGHGM
FLDEREKFTETLVSYVKSSQTV


References
    Title: Crystal Structure and Functional Characterization of an Esterase (EaEST) from Exiguobacterium antarcticum
    Lee CW, Kwon S, Park SH, Kim BY, Yoo W, Ryu BH, Kim HW, Shin SC, Kim S and Lee JH <2 more author(s)>
    Ref: PLoS ONE, 12:e0169540, 2017 : PubMed

            

    Title: Genome sequence of Exiguobacterium antarcticum B7, isolated from a biofilm in Ginger Lake, King George Island, Antarctica
    Carneiro AR, Ramos RT, Dall'Agnol H, Pinto AC, de Castro Soares S, Santos AR, Guimaraes LC, Almeida SS, Barauna RA and Silva A <17 more author(s)>
    Ref: Journal of Bacteriology, 194:6689, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer