Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: exoso-ACHE2

Exorista sorbillans acetylcholinesterase (ace)

Comment
Protein ADN37668.1 E2F270 is 353G and ADN37669.1 E2F271 is 353A Torpedo_number 227


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Exorista sorbillans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Calyptratae: N E > Oestroidea: N E > Tachinidae: N E > Exoristinae: N E > Exoristini: N E > Exorista: N E > Exorista sorbillans: N E


Molecular evidence
Database
1 mutation: exoso-ACHE2
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : HM028669, HM028670
2 UniProt : E2F270, E2F271
2 Ncbi-nid : 307147560, 307147562
2 Ncbi-pid : 307147561, 307147563
2 UniProt : E2F270, E2F271
2 Interpro : E2F270, E2F271
2 Prodom : E2F270, E2F271
2 Pfam : E2F270, E2F271
2 PIRSF : E2F270, E2F271
2 SUPERFAM : E2F270, E2F271
Sequence
Graphical view for this peptide sequence: exoso-ACHE2
Colored MSA for ACHE (raw)
MARFVKSSSSASCLSATTTFLPSASLSRSKVTLTSSSRNARSDVRNFFYA
FASLKRPSLSSLTQTSPNEFYRSFFATLVILLRMSSVAYGITDRLIVQTT
SGPVRGRSVSVQGHEVHVFTGIPYAKPPVEDLRFRKPVPAEPWHGVLDAT
RLPATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINIWAPVKAHLRHGR
GTNGNDHAGKADSEHLIFSAKPPQNTTNGLPVLIWIYGGGFMTGSATLNI
YNADIMAALGNVVVASFQYRVGAFGFLHLSPVMPGNEEEAPGNVGLWDQA
LALRWLKENARAFGGNPEWMTLFGESAGSSSVNAQLVSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLSENPQAVMACMRSVD
AKTISVQQWNSYSGILSFPSGPTIDGAFLPADPMTMMKTANMTGYDIMIG
NVRDEGTYFLLYDFIDYFDKDEATSLPRDKYLEIMNNIFNKATQAEREAI
IFQYTSWEGNPGYQNQQEIGRAVGDHFFTCPTNEYAQALAERGAQVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNS
VIEFAKTGKPAVEGEEWPSFSKEDPVYYVFSTEEKTEKLQRGPLAKRCSF
WNDYLPKVRSWVGSECENSNSASAAVAITYEQQHLVKWVIMLTIMVKSIF
Q
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARFVKSSSSASCLSATTTFLPSASLSRSKVTLTSSSRNARSDVRNFFYA
FASLKRPSLSSLTQTSPNEFYRSFFATLVILLRMSSVAYGITDRLIVQTT
SGPVRGRSVSVQGHEVHVFTGIPYAKPPVEDLRFRKPVPAEPWHGVLDAT
RLPATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINIWAPVKAHLRHGR
GTNGNDHAGKADSEHLIFSAKPPQNTTNGLPVLIWIYGGGFMTGSATLNI
YNADIMAALGNVVVASFQYRVGAFGFLHLSPVMPGNEEEAPGNVGLWDQA
LALRWLKENARAFGGNPEWMTLFGESAGSSSVNAQLVSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLSENPQAVMACMRSVD
AKTISVQQWNSYSGILSFPSGPTIDGAFLPADPMTMMKTANMTGYDIMIG
NVRDEGTYFLLYDFIDYFDKDEATSLPRDKYLEIMNNIFNKATQAEREAI
IFQYTSWEGNPGYQNQQEIGRAVGDHFFTCPTNEYAQALAERGAQVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNS
VIEFAKTGKPAVEGEEWPSFSKEDPVYYVFSTEEKTEKLQRGPLAKRCSF
WNDYLPKVRSWVGSECENSNSASAAVAITYEQQHLVKWVIMLTIMVKSIF
Q


Reference
    Title: Molecular characterization and inhibition analysis of the acetylcholinesterase gene from the silkworm maggot, Exorista sorbillans
    Lang GJ, Zhang MY, Li BL, Yu LL, Lu XM, Zhang CX
    Ref: BMB Rep, 43:573, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer