Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fugru-3neur

Fugu rubripes (Japanese pufferfish) (Takifugu rubripes) neuroligin 3

Comment
SINFRUG00000040649 SINFRUP00000040649 SINFRUG00000085195 SINFRUP00000087769


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Fugu rubripes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Tetraodontiformes: N E > Tetraodontoidei: N E > Tetradontoidea: N E > Tetraodontidae: N E > Takifugu: N E > Takifugu rubripes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: fugru-3neur
Colored MSA for Neuroligin (raw)
GVGLGVSFWVLSFCWCFANGQNYHPTVNTQYGKLRGVRVPLPSEILGPVD
QYLGVPYAASPVGEKRFMPPEPPSSWSGIKNATHFAPVCPQNIHNAVPEI
MMPIWFTFNLDIVTTYIQDQHEDCLYLNIYVPTEDVKRISKECARNPNKK
MCRKGGAHAKKQGEDLSDNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGN
MIDGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRW
ISENIGFFGGDSNRITVFGSGIGASCVSLLTLSHHSEGLFHRAIIQSGSA
LSSWAVNYQPVKYTRLLAEKVGCNVLDTLDMVDCLRKKSFRELVEQDIQP
ARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLRFVENV
VDSDDGVSGNDFDFSVSDFVDSLYGYPEGKDTLRETIKFMYTDWADRDNP
ETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHNCQSLMKPA
WSDAAHGDEVPYVFGIPLIGPTDLFPCNFSKNDAMLSVVVMTYWTNFAKT
GDPNKPVPQDTKFIHTKANRFEEVAWSKYNPQDQLYLHIGLKPRVRDHYR
ATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPEATQNTVSTKRPNGKTS
WPSNTKRPPMSPAYNSEDKDSWNEDKTGPLVVENPRDYSTELSVTIAVGA
SLLFLN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GVGLGVSFWVLSFCWCFANGQNYHPTVNTQYGKLRGVRVPLPSEILGPVD
QYLGVPYAASPVGEKRFMPPEPPSSWSGIKNATHFAPVCPQNIHNAVPEI
MMPIWFTFNLDIVTTYIQDQHEDCLYLNIYVPTEDVKRISKECARNPNKK
MCRKGGAHAKKQGEDLSDNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGN
MIDGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRW
ISENIGFFGGDSNRITVFGSGIGASCVSLLTLSHHSEGLFHRAIIQSGSA
LSSWAVNYQPVKYTRLLAEKVGCNVLDTLDMVDCLRKKSFRELVEQDIQP
ARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLRFVENV
VDSDDGVSGNDFDFSVSDFVDSLYGYPEGKDTLRETIKFMYTDWADRDNP
ETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHNCQSLMKPA
WSDAAHGDEVPYVFGIPLIGPTDLFPCNFSKNDAMLSVVVMTYWTNFAKT
GDPNKPVPQDTKFIHTKANRFEEVAWSKYNPQDQLYLHIGLKPRVRDHYR
ATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPEATQNTVSTKRPNGKTS
WPSNTKRPPMSPAYNSEDKDSWNEDKTGPLVVENPRDYSTELSVTIAVGA
SLLFLN


Reference
    Title: Whole-genome shotgun assembly and analysis of the genome of Fugu rubripes
    Aparicio S, Chapman J, Stupka E, Putnam N, Chia JM, Dehal P, Christoffels A, Rash S, Hoon S and Brenner S <31 more author(s)>
    Ref: Science, 297:1301, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer