fusox-CUT

 
Fusarium oxysporum (Fusarium vascular wilt) Cutinase FoCut5A

Comment
Other strains: Fusarium oxysporum (strain Fo5176; Fo47) (Fusarium vascular wilt) f. sp. (pisi HDV247; conglutinans race 2 54008; raphani 54005; lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936; MN25); cubense tropical race 4 54006; radicis-lycopersici 26381; vasinfectum 25433; melonis 26406; FOSC 3-a) The sequence here is the one in structure


Relationship
Family Cutinase
Block X
Fusarium oxysporum position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium oxysporum species complex: N E > Fusarium oxysporum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5AJH: Crystal structure of Fusarium oxysporum cutinase
No kinetic

Substrate: DEHP , Cutin ,

2 Genbank : EF613272, AFQF01003653
2 UniProt : A6N6J6, F9G833
1 Structure : 5AJH
>3 UniProtTrembl links 10 more: A6N6J6, F9G833, W9NVH0
>3 Interpro links 10 more: A6N6J6, F9G833, W9NVH0
>3 Prodom links 10 more: A6N6J6, F9G833, W9NVH0
>3 Pfam links 10 more: A6N6J6, F9G833, W9NVH0
>3 PIRSF links 10 more: A6N6J6, F9G833, W9NVH0
>3 SUPERFAM links 10 more: A6N6J6, F9G833, W9NVH0
>3 QuickSwissBlast links 10 more: A6N6J6, F9G833, W9NVH0
 
Sequence
Graphical view for this peptide sequence: fusox-CUT
Colored MSA for Cutinase (raw)
MLPAGQDAAALEARQLGGSITRNDLANGNSGSCPGVIFIYARGSTESGNL
GTLGPRVASKLEAKYGKNGVWIQGVGGAYRATLGDNALPRGTSSAAIREM
LGHFSDANQKCPDAVLIAGGYSQGAALAAASVTDVDAGIREKIAGAVLFG
YTKNLQNRGKIPSYPEDRTKVFCNTGDLVCTGSLIVAAPHLAYQSAASGA
APEFLIQKADAAGAAAAALE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLPAGQDAAALEARQLGGSITRNDLANGNSGSCPGVIFIYARGSTESGNL
GTLGPRVASKLEAKYGKNGVWIQGVGGAYRATLGDNALPRGTSSAAIREM
LGHFSDANQKCPDAVLIAGGYSQGAALAAASVTDVDAGIREKIAGAVLFG
YTKNLQNRGKIPSYPEDRTKVFCNTGDLVCTGSLIVAAPHLAYQSAASGA
APEFLIQKADAAGAAAAALE

no DNA




References
2 more
    Title: A highly conserved effector in Fusarium oxysporum is required for full virulence on Arabidopsis
    Thatcher LF, Gardiner DM, Kazan K, Manners JM
    Ref: Mol Plant Microbe Interact, 25:180, 2012 : PubMed

            

    Title: Ctf1, a transcriptional activator of cutinase and lipase genes in Fusarium oxysporum is dispensable for virulence
    Rocha AL, Di Pietro A, Ruiz-Roldan C, Roncero MI
    Ref: Mol Plant Pathol, 9:293, 2008 : PubMed

            

    Title: Degradation of an endocrine disrupting chemical, DEHP [di-(2-ethylhexyl)-phthalate], by Fusarium oxysporum f. sp. pisi cutinase
    Kim YH, Lee J, Moon SH
    Ref: Applied Microbiology & Biotechnology, 63:75, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer