Gene_locus Report for: gasac-ACHEEGasterosteus aculeatus (Three-spined stickleback) Cholinesterase-like Comment ENSGACP00000025718 This protein is a translation of transcript ENSGACT00000025768, which is a product of gene ENSGACG00000019455 Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Perciformes: N E > Cottioidei: N E > Gasterosteales: N E > Gasterosteidae: N E > Gasterosteus: N E > Gasterosteus aculeatus: N E
ABHD6-Lip : gasac-g3ne81Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3nik5Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein. ABHD8 : gasac-g3nyh0Gasterosteus aculeatus (Three-spined stickleback). Abhydrolase domain containing 8b, gasac-g3psi0Gasterosteus aculeatus (Three-spined stickleback). Abhydrolase domain containing 8a. ABHD10 : gasac-g3nf40Gasterosteus aculeatus (Three-spined stickleback). Abhydrolase domain-containing protein 10. ABHD11-Acetyl_transferase : gasac-g3qb38Gasterosteus aculeatus (Three-spined stickleback). Abhydrolase domain containing 11. ABHD13-BEM46 : gasac-g3nh84Gasterosteus aculeatus (Three-spined stickleback). Abhydrolase domain containing 13. ABHD16 : gasac-g3p4x2Gasterosteus aculeatus (Three-spined stickleback). Abhydrolase domain containing 16A. ABHD18 : gasac-g3q7j7Gasterosteus aculeatus (Three-spined stickleback). ABHD18 Uncharacterized protein. abh_upf0017 : gasac-g3p1r0Gasterosteus aculeatus (Three-spined stickleback). Abhydrolase domain containing 15a. ACHE : gasac-ACHEGasterosteus aculeatus (Three-spined stickleback) acetylcholinesterase. Arb2_FAM172A : gasac-g3p815Gasterosteus aculeatus (Three-spined stickleback). Family with sequence similarity 172, member A. Arylacetamide_deacetylase : gasac-g3na86Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein, gasac-g3nkj6Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein, gasac-g3p7g5Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein, gasac-g3pa32Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein. BCHE : gasac-BCHEGasterosteus aculeatus (Three-spined stickleback) Cholinesterase-like. Carb_B_Chordata : gasac-g3ndd6Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3nde0Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3pcs1Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3q0b0Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein. Cholesterol_esterase : gasac-balipGasterosteus aculeatus (Three-spined stickleback) Cholesterol_esterase, gasac-g3q258Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein. CIB-CCG1-interacting-factor-B : gasac-g3n8q7Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein. CMBL : gasac-g3ndq5Gasterosteus aculeatus (Three-spined stickleback). Carboxymethylenebutenolidase homolog (Pseudomonas). Hepatic_Lipase : gasac-g3pte3Gasterosteus aculeatus (Three-spined stickleback). Lipase, hepatic a. Lipoprotein_Lipase : gasac-g3nlf2Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein, gasac-g3pbm2Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein, gasac-g3pbr5Gasterosteus aculeatus (Three-spined stickleback). Lipoprotein lipase. Maspardin-ACP33-SPG21_like : gasac-g3pm38Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein. Monoglyceridelipase_lysophospholip : gasac-g3nqm5Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein. Ndr_family : gasac-g3ncd4Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3q570Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3p6y1Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3nrd6Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3nva1Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-g3n5r3Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein. Neuroligin : gasac-d2x2j3Gasterosteus aculeatus (Three-spined stickleback) Neuroligin 3a, gasac-d2x2j4Gasterosteus aculeatus (Three-spined stickleback) Neuroligin 3b, gasac-g3nsm5Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein, gasac-nlgn2aGasterosteus aculeatus (Three-spined stickleback) Neuroligin 2a, gasac-nlgn2bGasterosteus aculeatus (Three-spined stickleback) Neuroligin 2b, gasac-nlgn4Gasterosteus aculeatus (Three-spined stickleback) Neuroligin 4. NLS3-Tex30 : gasac-g3pa29Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein. Pectinacetylesterase-Notum : gasac-g3pas1Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein, gasac-g3q5l9Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein. Phospholipase : gasac-g3n954Gasterosteus aculeatus (Three-spined stickleback). Phospholipase A1 member A, gasac-g3qbs4Gasterosteus aculeatus (Three-spined stickleback). Lipase, member Ia. SERHL : gasac-g3pu21Gasterosteus aculeatus (Three-spined stickleback). Serine hydrolase-like, gasac-g3pu22Gasterosteus aculeatus (Three-spined stickleback). Serine hydrolase-like. Valacyclovir-hydrolase : gasac-g3nmi2Gasterosteus aculeatus (Three-spined stickleback) Uncharacterized protein
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: gasac-ACHEE Colored MSA for Cholinesterase-like (raw)
LNVLYLLVTDICYLGGDSVITLSKDGPITGVTVDKAHIFYGIPYADPPVG
AYRWKPPRPASPWLGVYDASFPRAACMQACSGPMAEECPRIVSEDCLYLN
VFVPLDVDFSCPLVAPLPVMVWIHGGDFIAGSASKPLYDGRFISNATKSV
VVSLEYRLGAFGFLVSGKDAHSAVGNYGILDQQAALLWVQRSIAAFGGDP
SKVTIFGESAGAQSVSLHLMIQSSKPLFKQAVLQSLPFSIPLKSRHDALK
LGKDFAKQTNCSVSDIVCLLSLAPQAVLAAQGLSCMHVNHNGLRFLEVFE
TWGPFIDGEFIKEQAVTAFQKGHWQKEKPVLLGTTSEEGVIFAYGVFNKP
VSALESAVYVTAIFKQHALRILHKYLPLYRDADRRGMLAQIVTDYVFHCP
SRSSARAGTATGSKVWMYMFDHVASDPRVWSGLTFCYEHACHGAELPFLF
GSASVANFTLSLSEKLLSNRMLCYWGAFAHTGDPSSRAQQTTFCHQQRLP
VWPRYADTSSWLVMNLTVRSHAQVGTRDHICDFWDHLGIYY
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
LNVLYLLVTDICYLGGDSVITLSKDGPITGVTVDKAHIFYGIPYADPPVG AYRWKPPRPASPWLGVYDASFPRAACMQACSGPMAEECPRIVSEDCLYLN VFVPLDVDFSCPLVAPLPVMVWIHGGDFIAGSASKPLYDGRFISNATKSV VVSLEYRLGAFGFLVSGKDAHSAVGNYGILDQQAALLWVQRSIAAFGGDP SKVTIFGESAGAQSVSLHLMIQSSKPLFKQAVLQSLPFSIPLKSRHDALK LGKDFAKQTNCSVSDIVCLLSLAPQAVLAAQGLSCMHVNHNGLRFLEVFE TWGPFIDGEFIKEQAVTAFQKGHWQKEKPVLLGTTSEEGVIFAYGVFNKP VSALESAVYVTAIFKQHALRILHKYLPLYRDADRRGMLAQIVTDYVFHCP SRSSARAGTATGSKVWMYMFDHVASDPRVWSGLTFCYEHACHGAELPFLF GSASVANFTLSLSEKLLSNRMLCYWGAFAHTGDPSSRAQQTTFCHQQRLP VWPRYADTSSWLVMNLTVRSHAQVGTRDHICDFWDHLGIYY
|
|
|