Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gasac-g3nkj6

Gasterosteus aculeatus (Three-spined stickleback). Uncharacterized protein

Relationship
Family|Arylacetamide_deacetylase
Block| H
Position in NCBI Life Tree|Gasterosteus aculeatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Perciformes: N E > Cottioidei: N E > Gasterosteales: N E > Gasterosteidae: N E > Gasterosteus: N E > Gasterosteus aculeatus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : G3NKJ6
1 UniProt : G3NKJ6
1 Interpro : G3NKJ6
1 Prodom : G3NKJ6
1 Pfam : G3NKJ6
1 PIRSF : G3NKJ6
1 SUPERFAM : G3NKJ6
Sequence
Graphical view for this peptide sequence: gasac-g3nkj6
Colored MSA for Arylacetamide_deacetylase (raw)
MDIGTAILIIGFAALVAAFLLLVIGLVYAELMNSDIPRGVANSGKLHMVH
GLFVGLAIVGRILDRLGICQQVNFVRWFVACFLTRLRPVPAGLRVKDLKF
SEVPVRLYEPTAMCDGLRRGLVYFHGGGWVLGNIDSVDEVCRHIAKESET
TVVSVGYRLAPEHRYPAQLDDCETALCHFLSVAEAEFSVDANRVAVGGDS
TGANMAAALCQRLARTEVGRLPFPCAQVLIYPTLQMADFNLPSYQQNHAV
PILFRGRMAFYFLQYLNGDVSLCQDLLEGIHVPTELKPSYKEWLSPSNLP
PEFLARGHSEIATAQYDAEVYHAIKAGLEHEVSPLLADDAAVRKTPPTFI
LTCEYDVLRDDGILYRKRLLDLKKDVTWRHVADGFHGVINFFNHGWLTFP
SAAHVVDSVVDYMRTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDIGTAILIIGFAALVAAFLLLVIGLVYAELMNSDIPRGVANSGKLHMVH
GLFVGLAIVGRILDRLGICQQVNFVRWFVACFLTRLRPVPAGLRVKDLKF
SEVPVRLYEPTAMCDGLRRGLVYFHGGGWVLGNIDSVDEVCRHIAKESET
TVVSVGYRLAPEHRYPAQLDDCETALCHFLSVAEAEFSVDANRVAVGGDS
TGANMAAALCQRLARTEVGRLPFPCAQVLIYPTLQMADFNLPSYQQNHAV
PILFRGRMAFYFLQYLNGDVSLCQDLLEGIHVPTELKPSYKEWLSPSNLP
PEFLARGHSEIATAQYDAEVYHAIKAGLEHEVSPLLADDAAVRKTPPTFI
LTCEYDVLRDDGILYRKRLLDLKKDVTWRHVADGFHGVINFFNHGWLTFP
SAAHVVDSVVDYMRTL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer