Gene_locus Report for: geos4-d3elv9Geobacillus sp. (strain Y412MC10) Dienelactone hydrolase-like protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus sp.: N E
5_AlphaBeta_hydrolase : geos4-d3efm9Geobacillus sp.; Paenibacillus uliginis; Paenibacillus aquistagni . Phospholipase/Carboxylesterase. 6_AlphaBeta_hydrolase : geos4-d3eaj0Geobacillus sp. (strain Y412MC10) Alpha/beta hydrolase fold protein. A85-EsteraseD-FGH : geos4-d3emc5Geobacillus sp. (strain Y412MC10) Putative esterase, geos4-d3emm7Geobacillus sp. (strain Y412MC10) Putative esterase. A85-Feruloyl-Esterase : geos4-d3eh10Geobacillus sp. (strain Y412MC10) Putative esterase. A85-IroE-IroD-Fes-Yiel : geos4-d3e9m1Geobacillus sp. (strain Y412MC10) Putative esterase, geos4-d3ea34Geobacillus sp. (strain Y412MC10) Putative esterase, geos4-d3efv8Geobacillus sp. (strain Y412MC10) Putative esterase, geosw-c5d7c8Geobacillus sp. (strain WCH70) Putative esterase. Abhydrolase_7 : geos4-d3eee7Geobacillus sp. (strain Y412MC10). Dienelactone hydrolase-like protein. Acetyl-esterase_deacetylase : geos4-d3ebq2Geobacillus sp. (strain Y412MC10) Putative uncharacterized protein, geos4-d3elw9Geobacillus sp. (strain Y412MC10) Acetyl xylan esterase. CarbLipBact_1 : geosw-c5d7l9Geobacillus sp. (strain WCH70) Carboxylesterase. CarbLipBact_2 : geosw-c5d4c8Geobacillus sp. (strain WCH70) Carboxylesterase, geos2-a0a0e0tby6Geobacillus sp.. BAAT/acyl-CoA thioester hydrolase. Carb_B_Bacteria : geos4-d3ed06Geobacillus sp. Paenibacillus sp. Carboxylesterase, geos4-d3edx2Geobacillus sp.; Paenibacillus sp.; Paenibacillus lautus Carboxylesterase, geosc-d7d055Geobacillus sp. Carboxylesterase type B. Chlorophyllase : geos4-d3eci6Geobacillus sp. (strain Y412MC10). Uncharacterized protein, geos4-d3ed68Geobacillus sp. (strain Y412MC10). Uncharacterized protein, geos4-d3ej43Geobacillus sp. (strain Y412MC10). Uncharacterized protein. Duf_2920 : geos0-e3iaz2Geobacillus sp. (strain Y4.1MC1) Uncharacterized protein. MenH_SHCHC : geosw-c5d6u7Geobacillus sp. (strain WCH70) Alpha/beta hydrolase fold protein. Monoglyceridelipase_lysophospholip : geos4-d3eet0Geobacillus sp. (strain Y412MC10) Alpha/beta hydrolase fold protein, geosw-c5d6e5Geobacillus sp. (strain WCH70) Alpha/beta hydrolase fold protein. Polyesterase-lipase-cutinase : geos4-d3eh34Geobacillus sp. (strain Y412MC10). Uncharacterized protein. Proline_iminopeptidase : geos4-d3ejy8Geobacillus sp. (strain Y412MC10). Alpha/beta hydrolase fold protein. RsbQ-like : geos4-d3ehw1Geobacillus sp. (strain Y412MC10) Alpha/beta hydrolase fold protein. UCP033634 : 9baci-a0a1q5skf3Geobacillus sp. (Bacillus thermoleovorans) Uncharacterized protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Paenibacillus sp. Y412MC10: N, E.
Geobacillus sp. Y412MC10: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: geos4-d3elv9
Colored MSA for Abhydrolase_7 (raw)
MWRADAFLESMYNEAVKKTKDSQAAMSAEERKRYLKQTLRRLIGEFETNE
NHKPVLLERESCDGYVRERVELSAVPGVSFAAYILIPEDQGKSMPAAVAV
HGHGYGSREIVGLRPDGSSDPNPPGIHRHFAVQLVQRGMVVIAPDVAGFG
ERRLAADLARNAEAANSCHRLSTQLLMHGKTLAGLRVAETLRALDYLAER
PEVQPDRIGIMGFSGGGLISFLCAALDERIRAAVLAGYPNTFKDSIMAVQ
HCICNYIPGMLNHAELPEWIGLIAPRPLYLESGADDRIFPAAGFNSAVEQ
LRDTYRRAGAEDRLQADLFPGAHEICGRYSYDWLFERLSSPEN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MWRADAFLESMYNEAVKKTKDSQAAMSAEERKRYLKQTLRRLIGEFETNE
NHKPVLLERESCDGYVRERVELSAVPGVSFAAYILIPEDQGKSMPAAVAV
HGHGYGSREIVGLRPDGSSDPNPPGIHRHFAVQLVQRGMVVIAPDVAGFG
ERRLAADLARNAEAANSCHRLSTQLLMHGKTLAGLRVAETLRALDYLAER
PEVQPDRIGIMGFSGGGLISFLCAALDERIRAAVLAGYPNTFKDSIMAVQ
HCICNYIPGMLNHAELPEWIGLIAPRPLYLESGADDRIFPAAGFNSAVEQ
LRDTYRRAGAEDRLQADLFPGAHEICGRYSYDWLFERLSSPEN
|
|
|
|
