Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geose-a0a023cin9

Geobacillus stearothermophilus NUB3621. Carboxylesterase type B

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Geobacillus stearothermophilus NUB3621
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Parageobacillus: N E > Parageobacillus genomosp. 1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AOTZ01000009
1 UniProt : A0A023CIN9
1 UniProt : A0A023CIN9
1 Interpro : A0A023CIN9
1 Prodom : A0A023CIN9
1 Pfam : A0A023CIN9
1 PIRSF : A0A023CIN9
1 SUPERFAM : A0A023CIN9
Sequence
Graphical view for this peptide sequence: geose-a0a023cin9
Colored MSA for Carb_B_Bacteria (raw)
MNTIVETRYGKLQGSKNGSVYCWKGVPYAKAPVGELRFQPPQPPEPWTGV
RDATTFGAVAMQPAGLLFGGVLGRTTEPRSEDCLFLNIWSPGADGKKRPV
MVWIHGGAFLFGSGSTPWYDGTAFAANGDVVVVTINYRLNVFGFLHLADL
FGEDYAASGNCGILDQIAALRWVQENIEAFGGDPKQVTIFGESAGAASVG
TLLAMPEAKGLFQKAILQSGSGALLLKSAAKATAMAEKILHQAGIRPGDR
DRLLTIPAEELLQAALSLGPQVSYGPVIDGKTLPNHPIEALKEGVARDIP
MIIGITKDEYNLFTLTDPSWTALSEQELLKRINKEVGPVPREVIDYYLHQ
GDEAEPIWQKLLRIMTYRVFTNGMFRTADYQVEQGANVWMYRFDYETPIM
GGKLKACHALELPFVFGNLHQPGITNFIGDLPEREQISKQMHDAWISFAH
NGNPNHNQLPEEWPAYDLNKRAAMIFGASSRVEADPFGKEREIWKKEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNTIVETRYGKLQGSKNGSVYCWKGVPYAKAPVGELRFQPPQPPEPWTGV
RDATTFGAVAMQPAGLLFGGVLGRTTEPRSEDCLFLNIWSPGADGKKRPV
MVWIHGGAFLFGSGSTPWYDGTAFAANGDVVVVTINYRLNVFGFLHLADL
FGEDYAASGNCGILDQIAALRWVQENIEAFGGDPKQVTIFGESAGAASVG
TLLAMPEAKGLFQKAILQSGSGALLLKSAAKATAMAEKILHQAGIRPGDR
DRLLTIPAEELLQAALSLGPQVSYGPVIDGKTLPNHPIEALKEGVARDIP
MIIGITKDEYNLFTLTDPSWTALSEQELLKRINKEVGPVPREVIDYYLHQ
GDEAEPIWQKLLRIMTYRVFTNGMFRTADYQVEQGANVWMYRFDYETPIM
GGKLKACHALELPFVFGNLHQPGITNFIGDLPEREQISKQMHDAWISFAH
NGNPNHNQLPEEWPAYDLNKRAAMIFGASSRVEADPFGKEREIWKKEK


Reference
    Title: Transformable facultative thermophile Geobacillus stearothermophilus NUB3621 as a host strain for metabolic engineering
    Blanchard K, Robic S, Matsumura I
    Ref: Applied Microbiology & Biotechnology, 98:6715, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer