Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geose-q93a71

Geobacillus stearothermophilus (Bacillus stearothermophilus) T6 lipase

Relationship
Family|Bacterial_lip_FamI.5
Block| L
Position in NCBI Life Tree|Geobacillus stearothermophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus stearothermophilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
15 structures (e.g. : 4FMP, 4X6U, 4X71... more)
No kinetic





No Substrate
No inhibitor
1 Genbank : AF429311
1 UniProt : Q93A71
>3 Structure links 12 more: 6S3G, 6S3J, 6S3V
1 UniProt : Q93A71
1 Interpro : Q93A71
1 Prodom : Q93A71
1 Pfam : Q93A71
1 PIRSF : Q93A71
1 SUPERFAM : Q93A71
Sequence
Graphical view for this peptide sequence: geose-q93a71
Colored MSA for Bacterial_lip_FamI.5 (raw)
MMKCCRRVALVLLGLWFVFCISVLGGRAEAAASRANDAPIVLLHGFTGWG
REEMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQL
VGGTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRIHIIAHSQGGQTAR
MLVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTL
VNMVDFTDRFFDLQKAVLKAAAVASNVPYTSQVYDFKLDQWGLRRQPGES
FDQYFERLKRSPVWTSTDTARYDLSVPGAEKLNQWVKASPNTYYLSFATE
RTYRGALTGNYYPELGMNAFSAVVCAPFLGSYRNATLGIDDRWLENDGIV
NTFSMNGPKRGSTDRIVPYDGTIKKGVWNDMGTYNVDHLEVIGVDPNPLF
DIRAFYLRLAEQLASLQP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKCCRRVALVLLGLWFVFCISVLGGRAEAAASRANDAPIVLLHGFTGWG
REEMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQL
VGGTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRIHIIAHSQGGQTAR
MLVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTL
VNMVDFTDRFFDLQKAVLKAAAVASNVPYTSQVYDFKLDQWGLRRQPGES
FDQYFERLKRSPVWTSTDTARYDLSVPGAEKLNQWVKASPNTYYLSFATE
RTYRGALTGNYYPELGMNAFSAVVCAPFLGSYRNATLGIDDRWLENDGIV
NTFSMNGPKRGSTDRIVPYDGTIKKGVWNDMGTYNVDHLEVIGVDPNPLF
DIRAFYLRLAEQLASLQP


References
3 more
    Title: Bridges to Stability: Engineering Disulfide Bonds Towards Enhanced Lipase Biodiesel Synthesis
    Gihaz S, Bash Y, Rush I, Shahar A, Pazy Y, Fishman A
    Ref: ChemCatChem, 12:181, 2020 : PubMed

            

    Title: Protein Engineering by Random Mutagenesis and Structure-Guided Consensus of Geobacillus stearothermophilus Lipase T6 for Enhanced Stability in Methanol
    Dror A, Shemesh E, Dayan N, Fishman A
    Ref: Applied Environmental Microbiology, 80:1515, 2014 : PubMed

            

    Title: High level expression and characterization of a novel thermostable, organic solvent tolerant, 1,3-regioselective lipase from Geobacillus sp. strain ARM
    Ebrahimpour A, Rahman RNZRA, Basri M, Salleh AB
    Ref: Bioresour Technol, 102:6972, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer