Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geost-lipas

Bacillus stearothermophilus Geobacillus stearothermophilus EH97 lipase gene, complete cds

Comment
EH97 promiscuous activity 11/96 substrates Martinez-Martinez et al. 2018 ; Sinchaikul sequence is from Bacillus stearothermophilus strain P1 (trembl Q9L6D3) and Kim from strain L1 (trembl O66015) some differences in sequences also between the two structure 1KUO and 1JI3


Relationship
Family|Bacterial_lip_FamI.5
Block| L
Position in NCBI Life Tree|Geobacillus stearothermophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus stearothermophilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 1JI3, 1KU0
No kinetic





No Substrate
No inhibitor
3 Genbank : U78785, AF237623, WP_041470719
2 Ncbi-nid : 3015529, 7208598
2 Ncbi-pid : 3015530, 7208599
2 Structure : 1JI3, 1KU0
2 UniProt : O66015, Q9L6D3
2 Interpro : O66015, Q9L6D3
2 Prodom : O66015, Q9L6D3
2 Pfam : O66015, Q9L6D3
2 PIRSF : O66015, Q9L6D3
2 SUPERFAM : O66015, Q9L6D3
Sequence
Graphical view for this peptide sequence: geost-lipas
Colored MSA for Bacterial_lip_FamI.5 (raw)
MMKGCRVMVVLLGLWFVFGLSVPGGRTEAASPRANDAPIVLLHGFTGWGR
EEMLGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLV
GGTVDYGAAHAANDGHARFGRTYPGLLPELKRGGRVHIIAHSQGGQTARM
LVSLLENGSQEEREYAKEHNVSLSPLFEGGHRFVLSVTTIATPHDGTTLV
NMVDFTDRFFDLQKAVLEAAAVASNAPYTSEIYDFKLDQWGLRREPGESF
DHYFERLKRSPVWTSTDTARYDLSVPGAETLNRWVKASPNTYYLSFSTER
TYRGALTGNYYPELGMNAFSAIVCAPFLGSYRNAALGIDSHWLGNDGIVN
TISMNGPKRGSNDRIVPYDGTLKKGVWNDMGTYKVDHLEVIGVDPNPSFN
IRAFYLRLAEQLASLRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKGCRVMVVLLGLWFVFGLSVPGGRTEAASPRANDAPIVLLHGFTGWGR
EEMLGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLV
GGTVDYGAAHAANDGHARFGRTYPGLLPELKRGGRVHIIAHSQGGQTARM
LVSLLENGSQEEREYAKEHNVSLSPLFEGGHRFVLSVTTIATPHDGTTLV
NMVDFTDRFFDLQKAVLEAAAVASNAPYTSEIYDFKLDQWGLRREPGESF
DHYFERLKRSPVWTSTDTARYDLSVPGAETLNRWVKASPNTYYLSFSTER
TYRGALTGNYYPELGMNAFSAIVCAPFLGSYRNAALGIDSHWLGNDGIVN
TISMNGPKRGSNDRIVPYDGTLKKGVWNDMGTYKVDHLEVIGVDPNPSFN
IRAFYLRLAEQLASLRP


References
5 more
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Structural modeling and characterization of a thermostable lipase from Bacillus stearothermophilus P1
    Sinchaikul S, Sookkheo B, Phutrakul S, Wu YT, Pan FM, Chen ST
    Ref: Biochemical & Biophysical Research Communications, 283:868, 2001 : PubMed

            

    Title: Gene cloning and characterization of thermostable lipase from Bacillus stearothermophilus L1
    Kim HK, Park SY, Lee JK, Oh TK
    Ref: Biosci Biotechnol Biochem, 62:66, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer