Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geoth-g8myf3

Geobacillus thermoleovorans EH68 Uncharacterized protein

Comment
EH68 promiscuous activity 18/96 substrates Martinez-Martinez et al. 2018 Other strains: Geobacillus sp. (B4113_201601; A8; enrichment culture clone fosmid MGS-MG1); Geobacillus thermoleovorans (Bacillus thermoleovorans) (B23; CCB_US3_UF5); Geobacillus thermocatenulatus


Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Geobacillus thermoleovorans CCB_US3_UF5
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus thermoleovorans group: N E > Geobacillus thermoleovorans: N E > Geobacillus thermoleovorans CCB_US3_UF5: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: geoth-g8myf3
Colored MSA for AlphaBeta_hydrolase (raw)
MIRFQYIESGGERLAVSIHDPAVSVDRDDVPVVVICHGFIGTRIGVDRLF
VQAAERFASAGVGVVRFDYAGCGESSGEYGKNRFDDFIRQTRDVIRTVEQ
FPSFQRRPLVLLGHSLGGAVATVTAALDRRVERLVLWAPVAYPHADIVRI
ATDGYGRSDGETIEYRGYRLSPSFFTSLVDIDPLQAAKQFPGDVLLVHGI
ADQEIPVMYADVYGEAFGQRADSRFAKHVISKADHTFSSVSAREQLLQIT
TAWLFQRAVVV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIRFQYIESGGERLAVSIHDPAVSVDRDDVPVVVICHGFIGTRIGVDRLF
VQAAERFASAGVGVVRFDYAGCGESSGEYGKNRFDDFIRQTRDVIRTVEQ
FPSFQRRPLVLLGHSLGGAVATVTAALDRRVERLVLWAPVAYPHADIVRI
ATDGYGRSDGETIEYRGYRLSPSFFTSLVDIDPLQAAKQFPGDVLLVHGI
ADQEIPVMYADVYGEAFGQRADSRFAKHVISKADHTFSSVSAREQLLQIT
TAWLFQRAVVV


Reference
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer