Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibf5-fub4

Gibberella fujikuroi(Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides); Fusarium oxysporum. Fusaric acid biosynthesis protein 4

Comment
Other strains: Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides); Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) (Fusarium vascular wilt of tomato). The polyketide synthase (PKS) FUB1 generates the triketide trans-2-hexenal which is presumptively released by the hydrolase FUB4 and linked to the NRPS-bound amino acid precursor by NAD(P)-dependent dehydrogenase FUB6


Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Gibberella fujikuroi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium fujikuroi species complex: N E > Fusarium fujikuroi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: gibf5-fub4
Colored MSA for FSH1 (raw)
MRFLCLHGYAFSVEVLQQQMEPITAHLPSDWEYEFLEAGMEPTELMLPNL
KQVPKPNYSWYNFPYPEDVEEAYERLAAYVESDGPFDGVWGFSQGGSMAA
LLLLMHQAEHPDTPYPFKMAIFTSAFLPHSFDNGVVSWDLTEKNTLEPTY
LPGRIDVSHGKKLDWKKDLHTSIEYDMINAVKDELDFPVDLLLRWRPSDI
PEKIPVPSVHVRGLKDHYSFVDESVYELFDPDMARKMTHRGGHNFPRYNE
ELVHFAELIIDTVVSLY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRFLCLHGYAFSVEVLQQQMEPITAHLPSDWEYEFLEAGMEPTELMLPNL
KQVPKPNYSWYNFPYPEDVEEAYERLAAYVESDGPFDGVWGFSQGGSMAA
LLLLMHQAEHPDTPYPFKMAIFTSAFLPHSFDNGVVSWDLTEKNTLEPTY
LPGRIDVSHGKKLDWKKDLHTSIEYDMINAVKDELDFPVDLLLRWRPSDI
PEKIPVPSVHVRGLKDHYSFVDESVYELFDPDMARKMTHRGGHNFPRYNE
ELVHFAELIIDTVVSLY


References
9 more
    Title: Antimycobacterial activity of fusaric acid from a mangrove endophyte and its metal complexes
    Pan JH, Chen Y, Huang YH, Tao YW, Wang J, Li Y, Peng Y, Dong T, Lai XM, Lin YC
    Ref: Arch Pharm Res, 34:1177, 2011 : PubMed

            

    Title: Bikaverin and fusaric acid from Fusarium oxysporum show antioomycete activity against Phytophthora infestans
    Son SW, Kim HY, Choi GJ, Lim HK, Jang KS, Lee SO, Lee S, Sung ND, Kim JC
    Ref: J Appl Microbiol, 104:692, 2008 : PubMed

            

    Title: Fusaric acid induces apoptosis in saffron root-tip cells: roles of caspase-like activity, cytochrome c, and H2O2
    Samadi L, Shahsavan Behboodi B
    Ref: Planta, 225:223, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer