Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibf5-fus2

Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides) 20-hydroxy-prefusarin hydrolase FUS2

Comment
Other strains: Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides). 20-hydroxy-prefusarin hydrolase; part of the gene cluster that mediates the biosynthesis of the mycotoxin fusarin C


Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Gibberella fujikuroi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium fujikuroi species complex: N E > Fusarium fujikuroi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CCT73261, DS022257, XP_018758498
2 UniProt : S0EE80, W7N6P0
2 UniProt : S0EE80, W7N6P0
2 Interpro : S0EE80, W7N6P0
2 Prodom : S0EE80, W7N6P0
2 Pfam : S0EE80, W7N6P0
2 PIRSF : S0EE80, W7N6P0
2 SUPERFAM : S0EE80, W7N6P0
Sequence
Graphical view for this peptide sequence: gibf5-fus2
Colored MSA for Duf_1100-S (raw)
MHKVFASDFFNFEFLRLLGTVPFQGAEVGECLTTAGRIKDGDPESWYRAW
RDQAEKAQALAEEAAAVGDKTGACWAYIRAANYWRASEFLLHCTPKDPRI
LASSKASVNAFDKGWVLLDATVKNFEIPYEKDIKLPGRLYLPAPHHRLPG
KIPVVLQTGGFDSTQEELYFYGAAGALPRGYAVFSFDGPGQGLPLRVGKL
KLRTDWEYVVSQVLDFVTDDVAPEYDLDLERLAIFGASLGGYLSLRAAVD
PRIKACVSCDGPLDLFEITRSRMPPWFINGWLSGWVSDGVFNWVVDGLTA
VNFQIAWEFGHGKWVFGVETPADVLRVMQKISLKGGYLEKIKCPTLITGA
ADSFYFTPDINANIIFEGLTALEPNDKHLWIGKGVEGGGLQAKIGALAVV
HHKMFTWLDSTFAIKRDVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHKVFASDFFNFEFLRLLGTVPFQGAEVGECLTTAGRIKDGDPESWYRAW
RDQAEKAQALAEEAAAVGDKTGACWAYIRAANYWRASEFLLHCTPKDPRI
LASSKASVNAFDKGWVLLDATVKNFEIPYEKDIKLPGRLYLPAPHHRLPG
KIPVVLQTGGFDSTQEELYFYGAAGALPRGYAVFSFDGPGQGLPLRVGKL
KLRTDWEYVVSQVLDFVTDDVAPEYDLDLERLAIFGASLGGYLSLRAAVD
PRIKACVSCDGPLDLFEITRSRMPPWFINGWLSGWVSDGVFNWVVDGLTA
VNFQIAWEFGHGKWVFGVETPADVLRVMQKISLKGGYLEKIKCPTLITGA
ADSFYFTPDINANIIFEGLTALEPNDKHLWIGKGVEGGGLQAKIGALAVV
HHKMFTWLDSTFAIKRDVL


References
1 more
    Title: Genetic manipulation of the Fusarium fujikuroi fusarin gene cluster yields insight into the complex regulation and fusarin biosynthetic pathway
    Niehaus EM, Kleigrewe K, Wiemann P, Studt L, Sieber CM, Connolly LR, Freitag M, Guldener U, Tudzynski B, Humpf HU
    Ref: Chemical Biology, 20:1055, 2013 : PubMed

            

    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            

    Title: Synthesis of [1,2-13C2, 15N]-L-homoserine and its incorporation by the PKS-NRPS system of Fusarium moniliforme into the mycotoxin fusarin C
    Rees DO, Bushby N, Cox RJ, Harding JR, Simpson TJ, Willis CL
    Ref: Chembiochem, 8:46, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer