(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Pezizomycotina: NE > leotiomyceta: NE > sordariomyceta: NE > Sordariomycetes: NE > Hypocreomycetidae: NE > Hypocreales: NE > Nectriaceae: NE > Fusarium: NE > Fusarium fujikuroi species complex: NE > Fusarium fujikuroi: NE
AlphaBeta_hydrolase : gibfu-Q92238Gibberella fujikuroi (Bakanae and foot rot disease fungus) gibberellin biosynthesis-related. Carboxypeptidase_S10 : gibfu-a4uvr3Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi). Serine carboxypeptidase. Carb_B_Bacteria : gibfu-a0a0i9xdz4Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) (contaminant from bacteria?) Uncharacterized protein. Duf_1100-S : gibf5-fus2Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides) 20-hydroxy-prefusarin hydrolase FUS2. FSH1 : gibf5-fub4Gibberella fujikuroi(Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides); Fusarium oxysporum. Fusaric acid biosynthesis protein 4, gibf5-fus5Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides). Fusarin biosynthesis protein 5. Fungal_carboxylesterase_lipase : gibf5-s0ea65Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase II, gibf5-s0enx6Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibf5-s0epd5Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to carboxylesterase, gibf5-s0dwm1Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Related to triacylglycerol lipase II, gibf5-s0egd1Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Related to triacylglycerol lipase II, gibf5-s0duw7Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibf5-s0ekf7Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibf5-s0e2n9Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibf5-s0en31Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to esterase, gibf5-s0e7t9Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibf5-s0eim9Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related toesterase, gibf5-s0drv8Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibf5-s0e9e0Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to esterase, gibf5-s0e3u9Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibf5-s0dzu5Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to carboxylesterase type B, gibf5-s0dqr2Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi), Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides) Related to triacylglycerol lipase II, gibf5-s0ecj3Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase V, gibfu-a0a0i9xsr6Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi). Cholinesterase, gibfu-a0a0i9zn28Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi). Cholinesterase. GTSAGmotif : gibf5-s0ekc4Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Uncharacterized protein. HOD-cofactorfree-dioxygenase : gibf5-s0ejq7Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi). Uncharacterized protein. Homoserine_transacetylase : gibf5-fub5Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides); Fusarium oxysporum f. sp. lycopersici(Fusarium vascular wilt of tomato). Fusaric acid biosynthesis protein 5. Kynurenine-formamidase : gibf5-s0eli0Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella intermedia (Bulb rot disease fungus) (Fusarium proliferatum). N-formylkynurenine formamidase, gibf5-s0dz40Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Fusarium mangiferae; Fusarium proliferatum. N-formylkynurenine formamidase. Thioesterase : gibfu-PKS4Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusariu polyketide synthase, gibf5-bik1Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi). Bikaverin biosynthesis protein 1; Thioesterase domain. Thiohydrolase : gibf5-fuj3Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi). Fujikurins biosynthesis cluster protein FFUJ_12241
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Fusarium fujikuroi IMI 58289: N, E.
Fusarium proliferatum ET1: N, E.
Fusarium mangiferae: N, E.
Fusarium proliferatum: N, E.
Gibberella intermedia: N, E.
Fusarium fujikuroi: N, E.
Fusarium nygamai: N, E.
Fusarium verticillioides 7600: N, E.
Gibberella moniliformis: N, E.
Fusarium verticillioides: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA RLHDVIRNAQRQVLQAKHNMIPLYIQREHLYKSYENQVLVTPGLHQEKKV LIIIHDPPELLAQPDVIDRSVDPHNAWVVDGVTDYIDWAVDQKFGVMDVN IPAYVTHDEESESYVPGFKEKALSEQIQTLVCYLWDNYLQLYDADHIFFM GVGNAYLGVKVLLLNRDCKSRISGVVNFANGTLRPVKSEFDSDLSSWYKE NSRVYIAGDHACWADPDLTRKVNKRRFGTVVRSPMFGLNKMMAHHAKEAR EWILERVEEVADADMTEDEKS
Species of the Fusarium fujikuroi species complex (FFC) cause a wide spectrum of often devastating diseases on diverse agricultural crops, including coffee, fig, mango, maize, rice, and sugarcane. Although species within the FFC are difficult to distinguish by morphology, and their genes often share 90% sequence similarity, they can differ in host plant specificity and life style. FFC species can also produce structurally diverse secondary metabolites (SMs), including the mycotoxins fumonisins, fusarins, fusaric acid, and beauvericin, and the phytohormones gibberellins, auxins, and cytokinins. The spectrum of SMs produced can differ among closely related species, suggesting that SMs might be determinants of host specificity. To date, genomes of only a limited number of FFC species have been sequenced. Here, we provide draft genome sequences of three more members of the FFC: a single isolate of F. mangiferae, the cause of mango malformation, and two isolates of F. proliferatum, one a pathogen of maize and the other an orchid endophyte. We compared these genomes to publicly available genome sequences of three other FFC species. The comparisons revealed species-specific and isolate-specific differences in the composition and expression (in vitro and in planta) of genes involved in SM production including those for phytohormome biosynthesis. Such differences have the potential to impact host specificity and, as in the case of F. proliferatum, the pathogenic versus endophytic life style.
The fungus Fusarium fujikuroi causes "bakanae" disease of rice due to its ability to produce gibberellins (GAs), but it is also known for producing harmful mycotoxins. However, the genetic capacity for the whole arsenal of natural compounds and their role in the fungus' interaction with rice remained unknown. Here, we present a high-quality genome sequence of F. fujikuroi that was assembled into 12 scaffolds corresponding to the 12 chromosomes described for the fungus. We used the genome sequence along with ChIP-seq, transcriptome, proteome, and HPLC-FTMS-based metabolome analyses to identify the potential secondary metabolite biosynthetic gene clusters and to examine their regulation in response to nitrogen availability and plant signals. The results indicate that expression of most but not all gene clusters correlate with proteome and ChIP-seq data. Comparison of the F. fujikuroi genome to those of six other fusaria revealed that only a small number of gene clusters are conserved among these species, thus providing new insights into the divergence of secondary metabolism in the genus Fusarium. Noteworthy, GA biosynthetic genes are present in some related species, but GA biosynthesis is limited to F. fujikuroi, suggesting that this provides a selective advantage during infection of the preferred host plant rice. Among the genome sequences analyzed, one cluster that includes a polyketide synthase gene (PKS19) and another that includes a non-ribosomal peptide synthetase gene (NRPS31) are unique to F. fujikuroi. The metabolites derived from these clusters were identified by HPLC-FTMS-based analyses of engineered F. fujikuroi strains overexpressing cluster genes. In planta expression studies suggest a specific role for the PKS19-derived product during rice infection. Thus, our results indicate that combined comparative genomics and genome-wide experimental analyses identified novel genes and secondary metabolites that contribute to the evolutionary success of F. fujikuroi as a rice pathogen.
Fusarium species are among the most important phytopathogenic and toxigenic fungi. To understand the molecular underpinnings of pathogenicity in the genus Fusarium, we compared the genomes of three phenotypically diverse species: Fusarium graminearum, Fusarium verticillioides and Fusarium oxysporum f. sp. lycopersici. Our analysis revealed lineage-specific (LS) genomic regions in F. oxysporum that include four entire chromosomes and account for more than one-quarter of the genome. LS regions are rich in transposons and genes with distinct evolutionary profiles but related to pathogenicity, indicative of horizontal acquisition. Experimentally, we demonstrate the transfer of two LS chromosomes between strains of F. oxysporum, converting a non-pathogenic strain into a pathogen. Transfer of LS chromosomes between otherwise genetically isolated strains explains the polyphyletic origin of host specificity and the emergence of new pathogenic lineages in F. oxysporum. These findings put the evolution of fungal pathogenicity into a new perspective.
