Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibze-q4i8l5

Gibberella zeae (Fusarium graminearum) 1-alkyl-2-acetylglycerophosphocholine esterase

Comment
Other strains: Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum)


Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Gibberella zeae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium sambucinum species complex: N E > Fusarium graminearum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AACM01000259, XP_011326041, CEF84480
2 UniProt : I1RQU3, A0A4E9EEB9
2 Interpro : I1RQU3, A0A4E9EEB9
2 Prodom : I1RQU3, A0A4E9EEB9
2 Pfam : I1RQU3, A0A4E9EEB9
2 PIRSF : I1RQU3, A0A4E9EEB9
2 SUPERFAM : I1RQU3, A0A4E9EEB9
Sequence
Graphical view for this peptide sequence: gibze-q4i8l5
Colored MSA for PAF-Acetylhydrolase (raw)
MHLSILFLSLLGIGTAINLPDPTGPYGVALRPQGMTDTKRIDPYDPKKGH
RQVLASIFWPIHSTVCSKEIVPYMPPAVAQFYGQQAQSMGLSNDTFAAFE
YAVCKTPASAKGCDSQRSFPLAVFSPGAGNSRLLYSNMARSLASYGNIVV
LIDHPYDADIVEFPDGQIIRSGNIPETTKSLIDLTKVRAMDISFVISKVL
QPSFQRKVFKGLPGSVDSKKVFALGHSLGGASAAVASLSDVRLRGGMDLD
GQIFEPALSKGLDKPFFLVGRPNHSKEDTTWKTFYAKLRGPKKEIAIKGT
VHGSFTDYPQLIQALHLPASTQKAVQQLVGDIDADYLQKFLSETTVRFMN
ISFGSEAKV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHLSILFLSLLGIGTAINLPDPTGPYGVALRPQGMTDTKRIDPYDPKKGH
RQVLASIFWPIHSTVCSKEIVPYMPPAVAQFYGQQAQSMGLSNDTFAAFE
YAVCKTPASAKGCDSQRSFPLAVFSPGAGNSRLLYSNMARSLASYGNIVV
LIDHPYDADIVEFPDGQIIRSGNIPETTKSLIDLTKVRAMDISFVISKVL
QPSFQRKVFKGLPGSVDSKKVFALGHSLGGASAAVASLSDVRLRGGMDLD
GQIFEPALSKGLDKPFFLVGRPNHSKEDTTWKTFYAKLRGPKKEIAIKGT
VHGSFTDYPQLIQALHLPASTQKAVQQLVGDIDADYLQKFLSETTVRFMN
ISFGSEAKV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer