Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: glovi-GLL2500

Gloeobacter violaceus proable homoserine o-acetyltransferase like

Relationship
Family|Homoserine_transacetylase_like_est
Block| X
Position in NCBI Life Tree|Gloeobacter violaceus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Gloeobacteria: N E > Gloeobacterales: N E > Gloeobacteraceae: N E > Gloeobacter: N E > Gloeobacter violaceus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP006576
1 UniProt : Q7NHN5
1 Interpro : Q7NHN5
1 Pfam : Q7NHN5
1 PIRSF : Q7NHN5
1 SUPERFAM : Q7NHN5
Sequence
Graphical view for this peptide sequence: glovi-GLL2500
Colored MSA for Homoserine_transacetylase_like_est (raw)
MTRSAEAFALENFALQCGTVLTRAQLVYQTHGELARGRDNAVLYPTSYGA
RHADIDWLIHPDRILDPRRYFVIVVNMFGNGLSTSPSNCEKCALAEQRFW
FTHFDNVRAQERLLIEVFGIERLAMVYGWSMGAQQAYHWGALYPERVERI
AALCGTARTTDHNRVFLESLRAALTADPAWTGSGFDGIPERGYRAFARIY
ASWAASQAFYREGLYYKLGYDSLEDYLQRGWEANYRKRNPHDLIAMIDTW
LRCDVGDNPIYRGDYCGALAAIRARTLVMPGATDLYFTPEDCAVEAARIP
DAEYRPIPSIWGHRAGNPYQNPEDAAFIRAAVRELLDRPAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRSAEAFALENFALQCGTVLTRAQLVYQTHGELARGRDNAVLYPTSYGA
RHADIDWLIHPDRILDPRRYFVIVVNMFGNGLSTSPSNCEKCALAEQRFW
FTHFDNVRAQERLLIEVFGIERLAMVYGWSMGAQQAYHWGALYPERVERI
AALCGTARTTDHNRVFLESLRAALTADPAWTGSGFDGIPERGYRAFARIY
ASWAASQAFYREGLYYKLGYDSLEDYLQRGWEANYRKRNPHDLIAMIDTW
LRCDVGDNPIYRGDYCGALAAIRARTLVMPGATDLYFTPEDCAVEAARIP
DAEYRPIPSIWGHRAGNPYQNPEDAAFIRAAVRELLDRPAL


Reference
    Title: Complete genome structure of Gloeobacter violaceus PCC 7421, a cyanobacterium that lacks thylakoids
    Nakamura Y, Kaneko T, Sato S, Mimuro M, Miyashita H, Tsuchiya T, Sasamoto S, Watanabe A, Kawashima K and Tabata S <9 more author(s)>
    Ref: DNA Research, 10:137, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer