Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gluox-q5fnv1

Gluconobacter oxydans (Gluconobacter suboxydans) Putative uncharacterized protein

Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Gluconobacter oxydans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodospirillales: N E > Acetobacteraceae: N E > Gluconobacter: N E > Gluconobacter oxydans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000009
1 UniProt : Q5FNV1
1 UniProt : Q5FNV1
1 Interpro : Q5FNV1
1 Pfam : Q5FNV1
1 PIRSF : Q5FNV1
1 SUPERFAM : Q5FNV1
Sequence
Graphical view for this peptide sequence: gluox-q5fnv1
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MTAVSRRKFVTAGAALASTAATIGLGASQARAAGGGHGFMAASSAGPDDF
DGPGPHRKKTPGLQGICALCEVTGGGEKVYGIAAEYDVAIDPASLTTDSY
ATAVFPAAKGFFAGMPQEPDKNDTSAVARPRPVSAIYTNSEAALRPDGKS
VEGRFVISEFHHDPDLSLPTTDSDRVSLVQKHGVRTLGGVTYAASQTVWS
NSGRHGNNVAIRGVDAWEQNHWWWDDTRSAWLEYSIYLPKSFLEKGGENR
AYPLILAVTHSGTSPDGTCAQTLTEQCIASIWSLPEVQDEHECVVITPRY
ERTTMNDYWEHTSDVENTYRLVESLLSNTWSYGNPNLPDRSDKVLKIDPK
RVYCTGWSMGAMTSLWLMAKHPQTFAAGLIIAGQQRPSDVVTLANQKLLI
ITGSEDNKATPWNEKCLPIWKQAGAKITRPDHNLDPALIFPVDRQDALTK
QINGYLAEGGNITFLTFQGVDHMGAARKFFHIAAARHWLLDQVRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAVSRRKFVTAGAALASTAATIGLGASQARAAGGGHGFMAASSAGPDDF
DGPGPHRKKTPGLQGICALCEVTGGGEKVYGIAAEYDVAIDPASLTTDSY
ATAVFPAAKGFFAGMPQEPDKNDTSAVARPRPVSAIYTNSEAALRPDGKS
VEGRFVISEFHHDPDLSLPTTDSDRVSLVQKHGVRTLGGVTYAASQTVWS
NSGRHGNNVAIRGVDAWEQNHWWWDDTRSAWLEYSIYLPKSFLEKGGENR
AYPLILAVTHSGTSPDGTCAQTLTEQCIASIWSLPEVQDEHECVVITPRY
ERTTMNDYWEHTSDVENTYRLVESLLSNTWSYGNPNLPDRSDKVLKIDPK
RVYCTGWSMGAMTSLWLMAKHPQTFAAGLIIAGQQRPSDVVTLANQKLLI
ITGSEDNKATPWNEKCLPIWKQAGAKITRPDHNLDPALIFPVDRQDALTK
QINGYLAEGGNITFLTFQGVDHMGAARKFFHIAAARHWLLDQVRA


Reference
    Title: Complete genome sequence of the acetic acid bacterium Gluconobacter oxydans
    Prust C, Hoffmeister M, Liesegang H, Wiezer A, Fricke WF, Ehrenreich A, Gottschalk G, Deppenmeier U
    Ref: Nat Biotechnol, 23:195, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer