Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gonpe-a0a150g7s4

Gonium pectorale, Putative uncharacterized protein

Comment
Green alga


Relationship
Family|Duf_1350
Block| X
Position in NCBI Life Tree|Gonium pectorale
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Chlorophyta: N E > Chlorophyceae: N E > Chlamydomonadales: N E > Volvocaceae: N E > Gonium: N E > Gonium pectorale: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A150G7S4
1 Interpro : A0A150G7S4
1 Pfam : A0A150G7S4
1 PIRSF : A0A150G7S4
1 SUPERFAM : A0A150G7S4
Sequence
Graphical view for this peptide sequence: gonpe-a0a150g7s4
Colored MSA for Duf_1350 (raw)
MQLDTGARAVTPQLRSKGLVHFLGGAFAGAAPQVAYGLLLDVVAAAGYTA
IATPYAVTFRHDECARAVRSLFLASVEELRNQPNGEALAPVGVPTFGVGH
SNGALLHLLIGSYFPGATDSNICISFNNKQVKDAIPVPGLMENLPGAVQA
ARAAAPNLPLPDLSSLPLPIPLPTTLPSGGQVLQAVASLLPRELGLDRAG
QLSGAGLLLDQIPAVFDEVGGGATDFYPSPAESRTIISQDYGVSPTLIVR
FSDDSIDESQEIVRLLQPKLGTGVTLLTLPGSHVTPCGGDVPWPTGPIFG
PADTLVQALKEQQTQDIQRLGKQLVGWLDYVSTR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQLDTGARAVTPQLRSKGLVHFLGGAFAGAAPQVAYGLLLDVVAAAGYTA
IATPYAVTFRHDECARAVRSLFLASVEELRNQPNGEALAPVGVPTFGVGH
SNGALLHLLIGSYFPGATDSNICISFNNKQVKDAIPVPGLMENLPGAVQA
ARAAAPNLPLPDLSSLPLPIPLPTTLPSGGQVLQAVASLLPRELGLDRAG
QLSGAGLLLDQIPAVFDEVGGGATDFYPSPAESRTIISQDYGVSPTLIVR
FSDDSIDESQEIVRLLQPKLGTGVTLLTLPGSHVTPCGGDVPWPTGPIFG
PADTLVQALKEQQTQDIQRLGKQLVGWLDYVSTR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer