Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gonpe-a0a150gb26

Gonium pectorale (Green alga). Uncharacterized protein

Relationship
Family|Chlorophyllase
Block| L
Position in NCBI Life Tree|Gonium pectorale
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Chlorophyta: N E > Chlorophyceae: N E > Chlamydomonadales: N E > Volvocaceae: N E > Gonium: N E > Gonium pectorale: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : LSYV01000041
1 UniProt : A0A150GB26
1 UniProt : A0A150GB26
1 Interpro : A0A150GB26
1 Pfam : A0A150GB26
1 PIRSF : A0A150GB26
1 SUPERFAM : A0A150GB26
Sequence
Graphical view for this peptide sequence: gonpe-a0a150gb26
Colored MSA for Chlorophyllase (raw)
MGPYPIVSLTQKVTIVPDGNTSSVNLDVNVTYPSNGPAPFPVLFMFNGFQ
ARASWYGGIVRHVASWGYVVVQYTHTGLLPIVVDRVELGYLSPLLAWVGA
RGRADGSPLRGLPDTARLVVMGHSRGGKLAALHFAGRRDISAAVLLDPID
NTSMAPEGPDYPSAAKALAAANRTAAIVGSGVNGSCNPAGANYPKFFTAM
APGSWQMVVKQAGHMQYCRTGNPLLDWGFDKLCGKGRISAQEVITDAAAF
AVAWLELSFRAKQAQSGLARFKGWVQSQVASGAVSFDVKEAPVTAPATSA
GGRAASQVPRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGPYPIVSLTQKVTIVPDGNTSSVNLDVNVTYPSNGPAPFPVLFMFNGFQ
ARASWYGGIVRHVASWGYVVVQYTHTGLLPIVVDRVELGYLSPLLAWVGA
RGRADGSPLRGLPDTARLVVMGHSRGGKLAALHFAGRRDISAAVLLDPID
NTSMAPEGPDYPSAAKALAAANRTAAIVGSGVNGSCNPAGANYPKFFTAM
APGSWQMVVKQAGHMQYCRTGNPLLDWGFDKLCGKGRISAQEVITDAAAF
AVAWLELSFRAKQAQSGLARFKGWVQSQVASGAVSFDVKEAPVTAPATSA
GGRAASQVPRA


Reference
    Title: The Gonium pectorale genome demonstrates co-option of cell cycle regulation during the evolution of multicellularity
    Hanschen ER, Marriage TN, Ferris PJ, Hamaji T, Toyoda A, Fujiyama A, Neme R, Noguchi H, Minakuchi Y and Olson BJ <12 more author(s)>
    Ref: Nat Commun, 7:11370, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer