Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gorgo-Y4neur

Gorilla gorilla (Western Gorilla) Neuroligin 4 Y-linked

Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Gorilla gorilla gorilla
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Gorilla: N E > Gorilla gorilla: N E > Gorilla gorilla gorilla: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FJ532261, GATR01000006
2 UniProt : C3UJQ3, W8CEL6
2 UniProt : C3UJQ3, W8CEL6
2 Interpro : C3UJQ3, W8CEL6
2 Prodom : C3UJQ3, W8CEL6
2 Pfam : C3UJQ3, W8CEL6
2 PIRSF : C3UJQ3, W8CEL6
2 SUPERFAM : C3UJQ3, W8CEL6
Sequence
Graphical view for this peptide sequence: gorgo-Y4neur
Colored MSA for Neuroligin (raw)
MSHPQGLLWLPLLFASVCVMLNSNVLLWITALAVKFTVTDSQAQYPVVNT
NYGKIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGI
RNATQFAAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLN
IYVPTEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVIT
INYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPSDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEILQYVSTTTKVPPPDMTSFPYGTRRSPTKIWPTTKRPAITPANNPKHS
KDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRRPSPQRNTTNDITHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTGPPDYTLTLRRSPDDIPLMTPNTITMIPNTLMGMQPLHTFNTFSG
GQNSTNLPHGHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSHPQGLLWLPLLFASVCVMLNSNVLLWITALAVKFTVTDSQAQYPVVNT
NYGKIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGI
RNATQFAAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLN
IYVPTEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVIT
INYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPSDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEILQYVSTTTKVPPPDMTSFPYGTRRSPTKIWPTTKRPAITPANNPKHS
KDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRRPSPQRNTTNDITHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTGPPDYTLTLRRSPDDIPLMTPNTITMIPNTLMGMQPLHTFNTFSG
GQNSTNLPHGHSTTRV


References
    Title: Origins and functional evolution of Y chromosomes across mammals
    Cortez D, Marin R, Toledo-Flores D, Froidevaux L, Liechti A, Waters PD, Grutzner F, Kaessmann H
    Ref: Nature, 508:488, 2014 : PubMed

            

    Title: Evolution of X-degenerate Y chromosome genes in greater apes: conservation of gene content in human and gorilla, but not chimpanzee
    Goto H, Peng L, Makova KD
    Ref: Journal of Molecular Evolution, 68:134, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer