Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gorgo-balip

Gorilla gorilla carboxyl-ester lipase (CEL) gene, complete cds

Comment
G3RIG4 Q9N1D1 different c-term only n-term Pfam A COesterase 4 544


Relationship
Family|Cholesterol_esterase
Block| C
Position in NCBI Life Tree|Gorilla gorilla gorilla
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Gorilla: N E > Gorilla gorilla: N E > Gorilla gorilla gorilla: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF206618
2 UniProt : G3RIG4, G3RIG2
1 Ncbi-nid : 8050555
1 Ncbi-pid : 8050556
3 UniProt : Q9N1D1, G3RIG4, G3RIG2
3 Interpro : Q9N1D1, G3RIG4, G3RIG2
3 Prodom : Q9N1D1, G3RIG4, G3RIG2
3 Pfam : Q9N1D1, G3RIG4, G3RIG2
3 PIRSF : Q9N1D1, G3RIG4, G3RIG2
3 SUPERFAM : Q9N1D1, G3RIG4, G3RIG2
Sequence
Graphical view for this peptide sequence: gorgo-balip
Colored MSA for Cholesterol_esterase (raw)
MLTMGRLQLIVLGLTCCWAVASAVKLGAVYTEGGFVEGVNKKLGLLGDSV
DIFKGIPFAAPTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGD
EDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDG
EEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRN
IAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPW
VIQKNPLFWAEKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGL
EYPMLHYVGFIPVIDGDFIPDDPVNLYANAADIDYIAGTNNMDGHIFASI
DMPAINKGNKKVTEEDFYKLVSEFTFTKGLRGAKTTFDVYTESWAQDPSQ
ENKKKTVVDLETDVLFLVPTEIALAQHRANAKSAKTYTYLFSHPSRMPVY
PKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDP
NMGHSAVPTHWEPYTTENGSYLEITKKIDSSSMKRSLRTNFLRYWTLTYL
ALPTVTD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLTMGRLQLIVLGLTCCWAVASAVKLGAVYTEGGFVEGVNKKLGLLGDSV
DIFKGIPFAAPTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGD
EDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDG
EEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRN
IAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPW
VIQKNPLFWAEKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGL
EYPMLHYVGFIPVIDGDFIPDDPVNLYANAADIDYIAGTNNMDGHIFASI
DMPAINKGNKKVTEEDFYKLVSEFTFTKGLRGAKTTFDVYTESWAQDPSQ
ENKKKTVVDLETDVLFLVPTEIALAQHRANAKSAKTYTYLFSHPSRMPVY
PKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDP
NMGHSAVPTHWEPYTTENGSYLEITKKIDSSSMKRSLRTNFLRYWTLTYL
ALPTVTD


Reference
    Title: Characterization of the gorilla carboxyl ester lipase locus, and the appearance of the carboxyl ester lipase pseudogene during primate evolution
    Madeyski K, Lidberg U, Bjursell G, Nilsson J
    Ref: Gene, 239:273, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer