Gene_locus Report for: gorgo-g3qe70Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 16B Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Gorilla: N E > Gorilla gorilla: N E > Gorilla gorilla gorilla: N E
ABHD6-Lip : gorgo-g3rid6Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. ABHD8 : gorgo-g3qsm9Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 8. ABHD10 : gorgo-g3rhg1Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 10. ABHD11-Acetyl_transferase : gorgo-g3qgi3Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 11. ABHD12-PHARC : gorgo-g3reg6Gorilla gorilla gorilla (Western lowland gorilla). Uncharacterized protein. ABHD13-BEM46 : gorgo-a0a2i2zrx6Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 13. ABHD16 : gorgo-g3r3b4Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 16A. ABHD18 : gorgo-g3rt47Gorilla gorilla gorilla (Lowland gorilla). ABHD18 Uncharacterized protein. abh_upf0017 : gorgo-g3r9p9Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 15. ACHE : gorgo-ACHEGorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. Arb2_FAM172A : gorgo-a0a2i2z2v0Gorilla gorilla gorilla (Western lowland gorilla). Family with sequence similarity 172 member A. Arylacetamide_deacetylase : gorgo-g3s7q3Gorilla gorilla gorilla (Western lowland gorilla). Uncharacterized protein. BCHE : gorgo-BCHEGorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. Carb_B_Chordata : gorgo-g3qh77Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3qyw6Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3qyy1Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3ryd4Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3sef0Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. Cholesterol_esterase : gorgo-balipGorilla gorilla carboxyl-ester lipase (CEL) gene, complete cds. CIB-CCG1-interacting-factor-B : gorgo-g3rj06Gorilla gorilla gorilla (Lowland gorilla). Uncharacterized protein. CMBL : gorgo-g3re16Gorilla gorilla gorilla (Western lowland gorilla). Carboxymethylenebutenolidase homolog. FSH1 : gorgo-g3r1s1Gorilla gorilla gorilla (Western lowland gorilla). OVCA2 serine hydrolase domain containing. Hepatic_Lipase : gorgo-g3qyk3Gorilla gorilla gorilla (Western lowland gorilla). Lipase C, hepatic type. Kynurenine-formamidase : gorgo-g3qvu4Gorilla gorilla gorilla (Western lowland gorilla). N-formylkynurenine formamidase. Lipase_3 : gorgo-g3qfr8Gorilla gorilla gorilla (Western lowland gorilla). Diacylglycerol lipase alpha. Lipoprotein_Lipase : gorgo-g3qe94Gorilla gorilla gorilla (Western lowland gorilla). Lipase G, endothelial type, gorgo-g3rhe2Gorilla gorilla gorilla (Western lowland gorilla). Lipoprotein lipase. Maspardin-ACP33-SPG21_like : gorgo-g3qq10Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. Monoglyceridelipase_lysophospholip : gorgo-g3qd66Gorilla gorilla gorilla (Western lowland gorilla). Uncharacterized protein. Ndr_family : gorgo-g3qr61Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3rgt6Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. Neuroligin : gorgo-g3r2e2Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3rbw3Gorilla gorilla gorilla (Lowland gorilla) Neuroligin 3, gorgo-Y4neurGorilla gorilla (Western Gorilla) Neuroligin 4 Y-linked. NLS3-Tex30 : gorgo-g3qds0Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3r0v3Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. Pancreatic_lipase : gorgo-g3r2a5Gorilla gorilla gorilla (Western lowland gorilla). Pancreatic lipase, gorgo-g3riw7Gorilla gorilla gorilla (Western lowland gorilla). Pancreatic lipase, gorgo-g3rqh2Gorilla gorilla gorilla (Western lowland gorilla). Pancreatic lipase. Phospholipase : gorgo-g3qkj4Gorilla gorilla gorilla (Western lowland gorilla). Phospholipase A1 member A, gorgo-g3s122Gorilla gorilla gorilla (Western lowland gorilla). Lipase H, gorgo-a0a2i2y3x8Gorilla gorilla gorilla (Western lowland gorilla). Lipase I. Thyroglobulin : gorgo-g3s7h8Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein. Valacyclovir-hydrolase : gorgo-g3ra28Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: gorgo-g3qe70 Colored MSA for ABHD16 (raw)
MCVICFVKALVHVFKIYLTASYTYTFRGWPVAFRWDDVRAVGRSSSHRAL
TCAAAAAGVWLLRNETLGGDALGRPPRGARSQAQCLLQQLRELPGQLASY
ALAHSLGRWLVYPGSVSLMTRALLPLLQQGQERLVERYHGRRAKLVACDG
NEIDTMFVDRRQHPGSHGHGLRLVICCEGNAGFYEMGCLSAPLEAGYSVL
GWNHPGFGSSTGVPFPQHDANAMDVVVKYALYRLHFSPAHLVVYGWSVGG
FTATWATMTYPELGALVLDATFDDLVPLALKVMPHSWKGLVVRTVREHFN
LNVAEQLCCYPGPVLLLRRTQDDVVSTSGRLRPLSPGDVEGNRGNELLLR
LLEHRYPVVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRS
YRERCEEELEGEEALGPHGPAFPWLVGQGLSSRRRRRLALFLARKHLKNV
EATHFSPLEPEEFQLPWRL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MCVICFVKALVHVFKIYLTASYTYTFRGWPVAFRWDDVRAVGRSSSHRAL TCAAAAAGVWLLRNETLGGDALGRPPRGARSQAQCLLQQLRELPGQLASY ALAHSLGRWLVYPGSVSLMTRALLPLLQQGQERLVERYHGRRAKLVACDG NEIDTMFVDRRQHPGSHGHGLRLVICCEGNAGFYEMGCLSAPLEAGYSVL GWNHPGFGSSTGVPFPQHDANAMDVVVKYALYRLHFSPAHLVVYGWSVGG FTATWATMTYPELGALVLDATFDDLVPLALKVMPHSWKGLVVRTVREHFN LNVAEQLCCYPGPVLLLRRTQDDVVSTSGRLRPLSPGDVEGNRGNELLLR LLEHRYPVVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRS YRERCEEELEGEEALGPHGPAFPWLVGQGLSSRRRRRLALFLARKHLKNV EATHFSPLEPEEFQLPWRL
|
|
|