Gene_locus Report for: gorgo-g3qyy1

Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein

Relationship

Family	\|	Carb_B_Chordata
Block	\|	C
Position in NCBI Life Tree	\|	Gorilla gorilla gorilla

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Gorilla: N E > Gorilla gorilla: N E > Gorilla gorilla gorilla: N E

There are 45 a/b hydrolases in Gorilla gorilla gorilla view in a: Table

ABHD6-Lip : gorgo-g3rid6Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
ABHD8 : gorgo-g3qsm9Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 8.
ABHD10 : gorgo-g3rhg1Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 10.
ABHD11-Acetyl_transferase : gorgo-g3qgi3Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 11.
ABHD12-PHARC : gorgo-g3reg6Gorilla gorilla gorilla (Western lowland gorilla). Uncharacterized protein.
ABHD13-BEM46 : gorgo-a0a2i2zrx6Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 13.
ABHD16 : gorgo-g3r3b4Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 16A, gorgo-g3qe70Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 16B.
ABHD18 : gorgo-g3rt47Gorilla gorilla gorilla (Lowland gorilla). ABHD18 Uncharacterized protein.
abh_upf0017 : gorgo-g3r9p9Gorilla gorilla gorilla (Western lowland gorilla). Abhydrolase domain containing 15.
ACHE : gorgo-ACHEGorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
Arb2_FAM172A : gorgo-a0a2i2z2v0Gorilla gorilla gorilla (Western lowland gorilla). Family with sequence similarity 172 member A.
Arylacetamide_deacetylase : gorgo-g3s7q3Gorilla gorilla gorilla (Western lowland gorilla). Uncharacterized protein.
BCHE : gorgo-BCHEGorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
Carb_B_Chordata : gorgo-g3qh77Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3qyw6Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3ryd4Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3sef0Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
Cholesterol_esterase : gorgo-balipGorilla gorilla carboxyl-ester lipase (CEL) gene, complete cds.
CIB-CCG1-interacting-factor-B : gorgo-g3rj06Gorilla gorilla gorilla (Lowland gorilla). Uncharacterized protein.
CMBL : gorgo-g3re16Gorilla gorilla gorilla (Western lowland gorilla). Carboxymethylenebutenolidase homolog.
FSH1 : gorgo-g3r1s1Gorilla gorilla gorilla (Western lowland gorilla). OVCA2 serine hydrolase domain containing.
Hepatic_Lipase : gorgo-g3qyk3Gorilla gorilla gorilla (Western lowland gorilla). Lipase C, hepatic type.
Kynurenine-formamidase : gorgo-g3qvu4Gorilla gorilla gorilla (Western lowland gorilla). N-formylkynurenine formamidase.
Lipase_3 : gorgo-g3qfr8Gorilla gorilla gorilla (Western lowland gorilla). Diacylglycerol lipase alpha.
Lipoprotein_Lipase : gorgo-g3qe94Gorilla gorilla gorilla (Western lowland gorilla). Lipase G, endothelial type, gorgo-g3rhe2Gorilla gorilla gorilla (Western lowland gorilla). Lipoprotein lipase.
Maspardin-ACP33-SPG21_like : gorgo-g3qq10Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
Monoglyceridelipase_lysophospholip : gorgo-g3qd66Gorilla gorilla gorilla (Western lowland gorilla). Uncharacterized protein.
Ndr_family : gorgo-g3qr61Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3rgt6Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
Neuroligin : gorgo-g3r2e2Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3rbw3Gorilla gorilla gorilla (Lowland gorilla) Neuroligin 3, gorgo-Y4neurGorilla gorilla (Western Gorilla) Neuroligin 4 Y-linked.
NLS3-Tex30 : gorgo-g3qds0Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein, gorgo-g3r0v3Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
Pancreatic_lipase : gorgo-g3r2a5Gorilla gorilla gorilla (Western lowland gorilla). Pancreatic lipase, gorgo-g3riw7Gorilla gorilla gorilla (Western lowland gorilla). Pancreatic lipase, gorgo-g3rqh2Gorilla gorilla gorilla (Western lowland gorilla). Pancreatic lipase.
Phospholipase : gorgo-g3qkj4Gorilla gorilla gorilla (Western lowland gorilla). Phospholipase A1 member A, gorgo-g3s122Gorilla gorilla gorilla (Western lowland gorilla). Lipase H, gorgo-a0a2i2y3x8Gorilla gorilla gorilla (Western lowland gorilla). Lipase I.
Thyroglobulin : gorgo-g3s7h8Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein.
Valacyclovir-hydrolase : gorgo-g3ra28Gorilla gorilla gorilla (Lowland gorilla) Uncharacterized protein

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		>3 Genbank links 9 more: CABD030101594, CABD030101595, CABD030101596 3 UniProt : G3QYY1, A0A2I2Z9U7, A0A2I2ZBM9 3 UniProt : G3QYY1, A0A2I2Z9U7, A0A2I2ZBM9 3 Interpro : G3QYY1, A0A2I2Z9U7, A0A2I2ZBM9 3 Pfam : G3QYY1, A0A2I2Z9U7, A0A2I2ZBM9 3 PIRSF : G3QYY1, A0A2I2Z9U7, A0A2I2ZBM9 3 SUPERFAM : G3QYY1, A0A2I2Z9U7, A0A2I2ZBM9

Sequence

Peptide

Graphical view for this peptide sequence: gorgo-g3qyy1
Colored MSA for Carb_B_Chordata (raw)
MERAVRVESRVLVGVVCLLLPCPATATGPEVAQPEVDTTLGRVRGRQVGV KGTDRLVNVFLGIPFAQPPLGPNRFSGPRPAQPWEGVRDASTAPPMCLQD VESMNNSRFVLNGKQQIFSVSEDCLVLNIYSPAEAPAGSGRPVMVWVHGG ALITGTATSYNGSALAAYGDVVVVTVQYRLGVLGFFSTGDEHAPGNQGFL DVVAALHWVQGNITPFGGDLNCVTVFGGSAGGSIISGLILSPVAAGLFHR AITQSGVITTPGIIDSHPWPLAQKITNTLACSSSSLAETVQCLRQKEGEE LVLSKKLKITIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSW LIPRGLGLLDTMEQMSREDMLAISTPVFTSLDVPPEMMPTVIDEYIGSNS DAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSFVK IKPAWVKADHAAEGAFVFGGPFLMDSSRLAFPEATEEEKQLTLTMMAQWT HFAWTGDPNSKGLPPWPQFNQAEQYLEINPVPRAGQKFREAWMQFWSETL PSKIQQWHQKKNRKAQEDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MERAVRVESRVLVGVVCLLLPCPATATGPEVAQPEVDTTLGRVRGRQVGV
KGTDRLVNVFLGIPFAQPPLGPNRFSGPRPAQPWEGVRDASTAPPMCLQD
VESMNNSRFVLNGKQQIFSVSEDCLVLNIYSPAEAPAGSGRPVMVWVHGG
ALITGTATSYNGSALAAYGDVVVVTVQYRLGVLGFFSTGDEHAPGNQGFL
DVVAALHWVQGNITPFGGDLNCVTVFGGSAGGSIISGLILSPVAAGLFHR
AITQSGVITTPGIIDSHPWPLAQKITNTLACSSSSLAETVQCLRQKEGEE
LVLSKKLKITIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSW
LIPRGLGLLDTMEQMSREDMLAISTPVFTSLDVPPEMMPTVIDEYIGSNS
DAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSFVK
IKPAWVKADHAAEGAFVFGGPFLMDSSRLAFPEATEEEKQLTLTMMAQWT
HFAWTGDPNSKGLPPWPQFNQAEQYLEINPVPRAGQKFREAWMQFWSETL
PSKIQQWHQKKNRKAQEDL

No Reference

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer