Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: haein-HI0193

Haemophilus influenzae Rd (and strain 86-028NP) gene HI0193 esterase/lipase putative

Relationship
Family|ABHD11-Acetyl_transferase
Block| X
Position in NCBI Life Tree|Haemophilus influenzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pasteurellales: N E > Pasteurellaceae: N E > Haemophilus: N E > Haemophilus influenzae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : U32704, CP000057
2 UniProt : Q57427, Q4QNZ8
1 Ncbi-nid : 1573143
1 Ncbi-pid : 1573150
2 UniProt : Q57427, Q4QNZ8
2 Interpro : Q57427, Q4QNZ8
2 Prodom : Q57427, Q4QNZ8
2 Pfam : Q57427, Q4QNZ8
2 PIRSF : Q57427, Q4QNZ8
2 SUPERFAM : Q57427, Q4QNZ8
Sequence
Graphical view for this peptide sequence: haein-HI0193
Colored MSA for ABHD11-Acetyl_transferase (raw)
MIFIFISLFAKIFFNYNDFFTNSHVKIMAKSLLNYQFHQVKQTINTPVLI
FIHGLFGDMDNLGVIARAFSEHYSILRIDLRNHGHSFHSEKMNYQLMAED
VIAVIRHLNLSKVILIGHSMGGKTAMKITALCPELVEKLIVIDMSPMPYE
GFGHKDVFNGLFAVKNAKPENRQQAKPILKQEINDEDVVQFMLKSFDVNS
ADCFRFNLTALFNNYANIMDWEKVRVFTPTLFIKGGNSSYIKIENSEKIL
EQFPNATAFTINGSGHWVHAEKPDFVIRAIKRFLNKN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIFIFISLFAKIFFNYNDFFTNSHVKIMAKSLLNYQFHQVKQTINTPVLI
FIHGLFGDMDNLGVIARAFSEHYSILRIDLRNHGHSFHSEKMNYQLMAED
VIAVIRHLNLSKVILIGHSMGGKTAMKITALCPELVEKLIVIDMSPMPYE
GFGHKDVFNGLFAVKNAKPENRQQAKPILKQEINDEDVVQFMLKSFDVNS
ADCFRFNLTALFNNYANIMDWEKVRVFTPTLFIKGGNSSYIKIENSEKIL
EQFPNATAFTINGSGHWVHAEKPDFVIRAIKRFLNKN


References
    Title: Genomic sequence of an otitis media isolate of nontypeable Haemophilus influenzae: comparative study with H. influenzae serotype d, strain KW20
    Harrison A, Dyer DW, Gillaspy A, Ray WC, Mungur R, Carson MB, Zhong H, Gipson J, Gipson M and Munson RS, Jr. <3 more author(s)>
    Ref: Journal of Bacteriology, 187:4627, 2005 : PubMed

            

    Title: Metabolism and evolution of Haemophilus influenzae deduced from a whole-genome comparison with Escherichia coli
    Tatusov RL, Mushegian AR, Bork P, Brown NP, Hayes WS
    Ref: Current Biology, 6:279, 1996 : PubMed

            

    Title: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd
    Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA and Venter JC <31 more author(s)>
    Ref: Science, 269:496, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer