Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: haein-metx

Haemophilus influenzae Homoserine O-acetyltransferase (hta)

Comment
Other strains: Haemophilus influenzae (86-028NP; PittEE; PittAA; R3021; 22.4-21; PittHH; PittII; 22.1-21; 3655; PittGG


Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Haemophilus influenzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pasteurellales: N E > Pasteurellaceae: N E > Haemophilus: N E > Haemophilus influenzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
2B61: Crystal Structure Of Homoserine Transacetylase from Haemophilus Influenzae
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: haein-metx
Colored MSA for Homoserine_transacetylase (raw)
SVQNVVLFDTQPLTLMLGGKLSHINVAYQTYGTLNAEKNNAVLICHALTG
DAEPYFDDGRDGWWQNFMGAGLALDTDRYFFISSNVLGGCKGTTGPSSIN
PQTGKPYGSQFPNIVVQDIVKVQKALLDHLGISHLKAIIGGSFGGMQANQ
WAIDYPDFMDNIVNLCSSIYFSAEAIGFNHVMRQAVINDPNFNGGDYYEG
TPPDQGLSIARMLGMLTYRTDLQLAKAFGRATKSDGSFWGDYFQVESYLS
YQGKKFLERFDANSYLHLLRALDMYDPSLGYDNVKEALSRIKARYTLVSV
TTDQLFKPIDLYKSKQLLEQSGVDLHFYEFPSDYGHDAFLVDYDQFEKRI
RDGLAGN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SVQNVVLFDTQPLTLMLGGKLSHINVAYQTYGTLNAEKNNAVLICHALTG
DAEPYFDDGRDGWWQNFMGAGLALDTDRYFFISSNVLGGCKGTTGPSSIN
PQTGKPYGSQFPNIVVQDIVKVQKALLDHLGISHLKAIIGGSFGGMQANQ
WAIDYPDFMDNIVNLCSSIYFSAEAIGFNHVMRQAVINDPNFNGGDYYEG
TPPDQGLSIARMLGMLTYRTDLQLAKAFGRATKSDGSFWGDYFQVESYLS
YQGKKFLERFDANSYLHLLRALDMYDPSLGYDNVKEALSRIKARYTLVSV
TTDQLFKPIDLYKSKQLLEQSGVDLHFYEFPSDYGHDAFLVDYDQFEKRI
RDGLAGN


References
3 more
    Title: Genomic sequence of an otitis media isolate of nontypeable Haemophilus influenzae: comparative study with H. influenzae serotype d, strain KW20
    Harrison A, Dyer DW, Gillaspy A, Ray WC, Mungur R, Carson MB, Zhong H, Gipson J, Gipson M and Munson RS, Jr. <3 more author(s)>
    Ref: Journal of Bacteriology, 187:4627, 2005 : PubMed

            

    Title: Enzyme-catalyzed acylation of homoserine: mechanistic characterization of the Haemophilus influenzae met2-encoded homoserine transacetylase
    Born TL, Franklin M, Blanchard JS
    Ref: Biochemistry, 39:8556, 2000 : PubMed

            

    Title: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd
    Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA and Venter JC <31 more author(s)>
    Ref: Science, 269:496, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer