Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: haein-yfbb

Haemophilus influenzae, Haemophilus aegyptius, Haemophilus haemolyticus, hypothetical protein hi0282

Comment
Other strains: Haemophilus influenzae ( and strains 86-028NP; 22.4-21; PittAA; PittGGPittEE; R3021; 3655; PittII 22.1-2;1 PittHH; F3031; F3047; 10810; R2846/12; R2866; 7P49H1; 6P18H1; NT127; RdAW) Haemophilus aegyptius ATCC 11116 Haemophilus haemolyticus (M19107; M19501; M21127; M21621; M21639; HK386)


Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Haemophilus influenzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pasteurellales: N E > Pasteurellaceae: N E > Haemophilus: N E > Haemophilus influenzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: haein-yfbb
Colored MSA for MenH_SHCHC (raw)
MINIIFLHGLLGTKNDWQKVIENLPHFNCIALDLPFHGQAKDLEVTNFED
SAEYLAQQIKSAVKNGPYFLVGYSLGGRIALYYALQAQLERSNLQGVILE
GANLGLKTDEEKQARFQQDFAWAQRFMQESPEKVLNDWYQQPVFSHLTTE
ERLQLVEKRKSNCGKNIGKMLLATSLSKQPDFSEKVRLSSLPFFYFCGER
DHKFQVLAKENQIDLVTIPCAGHNSHLENSKYFSKKIENCILKIVRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MINIIFLHGLLGTKNDWQKVIENLPHFNCIALDLPFHGQAKDLEVTNFED
SAEYLAQQIKSAVKNGPYFLVGYSLGGRIALYYALQAQLERSNLQGVILE
GANLGLKTDEEKQARFQQDFAWAQRFMQESPEKVLNDWYQQPVFSHLTTE
ERLQLVEKRKSNCGKNIGKMLLATSLSKQPDFSEKVRLSSLPFFYFCGER
DHKFQVLAKENQIDLVTIPCAGHNSHLENSKYFSKKIENCILKIVRP


References
1 more
    Title: Characterization and modeling of the Haemophilus influenzae core and supragenomes based on the complete genomic sequences of Rd and 12 clinical nontypeable strains
    Hogg JS, Hu FZ, Janto B, Boissy R, Hayes J, Keefe R, Post JC, Ehrlich GD
    Ref: Genome Biol, 8:R103, 2007 : PubMed

            

    Title: Genomic sequence of an otitis media isolate of nontypeable Haemophilus influenzae: comparative study with H. influenzae serotype d, strain KW20
    Harrison A, Dyer DW, Gillaspy A, Ray WC, Mungur R, Carson MB, Zhong H, Gipson J, Gipson M and Munson RS, Jr. <3 more author(s)>
    Ref: Journal of Bacteriology, 187:4627, 2005 : PubMed

            

    Title: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd
    Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA and Venter JC <31 more author(s)>
    Ref: Science, 269:496, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer