Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: haldh-a0a1x9t5x9

Haliotis discus hannai (Japanese abalone) Prolyl endopeptidase

Relationship
Family|S9N_PPCE_Peptidase_S9
Block| X
Position in NCBI Life Tree|Haliotis discus hannai
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Mollusca: N E > Gastropoda: N E > Vetigastropoda: N E > Lepetellida: N E > Haliotoidea: N E > Haliotidae: N E > Haliotis: N E > Haliotis discus: N E > Haliotis discus hannai: N E


Molecular evidence
Database
No mutation
2 structures: 6JCI, 6JYM
No kinetic





No Substrate
1 inhbitor:
SUAM-14746
1 Genbank : ARR29117
1 UniProt : A0A1X9T5X9
2 Structure : 6JYM, 6JCI
1 UniProt : A0A1X9T5X9
1 Interpro : A0A1X9T5X9
1 Pfam : A0A1X9T5X9
1 PIRSF : A0A1X9T5X9
1 SUPERFAM : A0A1X9T5X9
Sequence
Graphical view for this peptide sequence: haldh-a0a1x9t5x9
Colored MSA for S9N_PPCE_Peptidase_S9 (raw)
MGKFTYPNARRDELVEDYHGTKVTEYYRWLEDPDSEETKAFVEAQNELSK
PFLDACPIREKLSSRITEVWDYPKYSCPGRHGEYFYYYHNTGLQNQSVLY
AQKGLGADPSVFLDPNSLSEDGTVSLRGTAFSENDQFFAYGLSKSGSDWV
TIKFKKAPSGEDLPDTLERVKFSSMAWTHDHKGLFYNRYLEQQGKSDGTE
TTMNVDQKLFYHRLGTDQSEDVLVAEFPEHPRWMIGAEVSDCGRYLVMTI
HEGCDPVNRLYYVDLKSMQNEIRGVLSYVKIVDNFDAEYEYITNDGSKFT
FKTNLNASRYKLINIDFADPDQSNWQTLVDEDEKSVLEWAACVNKDKLIL
CYLKDVKNELYVHGLSSGSRMSQLPLEVGSVVGYSGKKKYDEIFYQFTSF
LTPGIIYRCDMTTDTYTPKTFREIKVKDFDTSQFETEQVFFPSKDGTKIP
MFIVHRKGLVHDGSHPVMLYGYGGFNISITPSFSPSRLVFLQHLGGVYAI
ANIRGGGEYGESWHKAGNCANKQNVFDDFQSAAQYLIENKWTSAKRITIN
GGSNGGLLVGACINQRPDLFGCAVAQVGVLDMLRFHKFTIGHAWTTDYGS
SDSTDDFKVLIKYSPLHNIREQKDQYPALLLLTGDHDDRVVPLHSLKFLA
QIQYTFKDSDSQTNPLMGRIDTKSGHGFGKPTAKVIEELTDIYSFMHQTV
GLKWSD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGKFTYPNARRDELVEDYHGTKVTEYYRWLEDPDSEETKAFVEAQNELSK
PFLDACPIREKLSSRITEVWDYPKYSCPGRHGEYFYYYHNTGLQNQSVLY
AQKGLGADPSVFLDPNSLSEDGTVSLRGTAFSENDQFFAYGLSKSGSDWV
TIKFKKAPSGEDLPDTLERVKFSSMAWTHDHKGLFYNRYLEQQGKSDGTE
TTMNVDQKLFYHRLGTDQSEDVLVAEFPEHPRWMIGAEVSDCGRYLVMTI
HEGCDPVNRLYYVDLKSMQNEIRGVLSYVKIVDNFDAEYEYITNDGSKFT
FKTNLNASRYKLINIDFADPDQSNWQTLVDEDEKSVLEWAACVNKDKLIL
CYLKDVKNELYVHGLSSGSRMSQLPLEVGSVVGYSGKKKYDEIFYQFTSF
LTPGIIYRCDMTTDTYTPKTFREIKVKDFDTSQFETEQVFFPSKDGTKIP
MFIVHRKGLVHDGSHPVMLYGYGGFNISITPSFSPSRLVFLQHLGGVYAI
ANIRGGGEYGESWHKAGNCANKQNVFDDFQSAAQYLIENKWTSAKRITIN
GGSNGGLLVGACINQRPDLFGCAVAQVGVLDMLRFHKFTIGHAWTTDYGS
SDSTDDFKVLIKYSPLHNIREQKDQYPALLLLTGDHDDRVVPLHSLKFLA
QIQYTFKDSDSQTNPLMGRIDTKSGHGFGKPTAKVIEELTDIYSFMHQTV
GLKWSD


Reference
    Title: Characterization and crystal structure of prolyl endopeptidase from abalone (Haliotis discus hannai)
    Li WY, Li Y, Chen YL, Hu JJ, Mengist HM, Liu GM, Jin T, Cao MJ
    Ref: Food Chem, 333:127452, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer