Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: halsp-YUXL

Halobacterium salinarum, Halobacterium sp., Haloterrigena turkmenica, acylaminoacyl-peptidase

Comment
Other strains: Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) Halobacterium sp. (strain NRC-1 / ATCC 700922 / JCM 11081); Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) (Halococcus turkmenicus)


Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Halobacterium sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Halobacteria: N E > Halobacteriales: N E > Halobacteriaceae: N E > Halobacterium: N E > Halobacterium sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AE005114, AM774415, CP001860
2 UniProt : B0R7J8, D2RTH4
3 UniProt : Q9HN07, B0R7J8, D2RTH4
3 Interpro : Q9HN07, B0R7J8, D2RTH4
3 Prodom : Q9HN07, B0R7J8, D2RTH4
3 Pfam : Q9HN07, B0R7J8, D2RTH4
3 PIRSF : Q9HN07, B0R7J8, D2RTH4
3 SUPERFAM : Q9HN07, B0R7J8, D2RTH4
Sequence
Graphical view for this peptide sequence: halsp-YUXL
Colored MSA for ACPH_Peptidase_S9 (raw)
MQPVEASDYWELARLSQPAVSPTGDRVAYVRTTAERDGDTGQETASVHVA
PVGGGGSRRFTAADGTDAEPAWSPTGDRLAFVSTRGDAGGGRPQLWVVPV
DGGEATRITDVIGGVSNIAWGPDGDRVAFLQAVRPAERAEELDREHDGEY
ERDTPDPRVIDRQMYRGHTSYRDGARRHVYVADLAAGRVDRVTAGVAECG
GPAWGDDGTLYYPIRRGLDADDRLEWAIEAATPADSADSTVVTTVEGMGP
TLAVHGSRVAYTTTPADDPTLTQTAVEVFDRDTGATDRLTDGVDRTVAER
TAGHAPEWGPDGEHLYVCTPDEGGYVLRRVAADTGDDRVVLAGDRHVHAF
SVSADAVAVVQSEWDHPGEVVAATPMGGEEVTLTRANRDYLDERAVSKPE
SVWIDGPAGDIQGWVLTPPEFDPEETYPLVVNVHGGPHLMWSAAGTMWHE
FQTLAARGYVVFWCNPRGSTGYGQEWLRAVERDWGAVTLADVMAGVAAVT
DRDYVDADNAFITGGSFGGFMTGWAVGHTDAFAGAVAQRGVYDLTGFYGT
TDAYALVEGEFDTDPVRDNAFLWAQSPAAHTDAVDTPTLLVHSEADYRTP
ANTAELFYRLLKKHGVDTRLVRYPGEGHDLSRSGDPGHVVDRIERIAAWF
DGYSDHHEAAPVLETDRPGAAADE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQPVEASDYWELARLSQPAVSPTGDRVAYVRTTAERDGDTGQETASVHVA
PVGGGGSRRFTAADGTDAEPAWSPTGDRLAFVSTRGDAGGGRPQLWVVPV
DGGEATRITDVIGGVSNIAWGPDGDRVAFLQAVRPAERAEELDREHDGEY
ERDTPDPRVIDRQMYRGHTSYRDGARRHVYVADLAAGRVDRVTAGVAECG
GPAWGDDGTLYYPIRRGLDADDRLEWAIEAATPADSADSTVVTTVEGMGP
TLAVHGSRVAYTTTPADDPTLTQTAVEVFDRDTGATDRLTDGVDRTVAER
TAGHAPEWGPDGEHLYVCTPDEGGYVLRRVAADTGDDRVVLAGDRHVHAF
SVSADAVAVVQSEWDHPGEVVAATPMGGEEVTLTRANRDYLDERAVSKPE
SVWIDGPAGDIQGWVLTPPEFDPEETYPLVVNVHGGPHLMWSAAGTMWHE
FQTLAARGYVVFWCNPRGSTGYGQEWLRAVERDWGAVTLADVMAGVAAVT
DRDYVDADNAFITGGSFGGFMTGWAVGHTDAFAGAVAQRGVYDLTGFYGT
TDAYALVEGEFDTDPVRDNAFLWAQSPAAHTDAVDTPTLLVHSEADYRTP
ANTAELFYRLLKKHGVDTRLVRYPGEGHDLSRSGDPGHVVDRIERIAAWF
DGYSDHHEAAPVLETDRPGAAADE


References
    Title: Complete genome sequence of Haloterrigena turkmenica type strain (4k)
    Saunders E, Tindall BJ, Fahnrich R, Lapidus A, Copeland A, Del Rio TG, Lucas S, Chen F, Tice H and Kyrpides NC <24 more author(s)>
    Ref: Stand Genomic Sci, 2:107, 2010 : PubMed

            

    Title: Evolution in the laboratory: the genome of Halobacterium salinarum strain R1 compared to that of strain NRC-1
    Pfeiffer F, Schuster SC, Broicher A, Falb M, Palm P, Rodewald K, Ruepp A, Soppa J, Tittor J, Oesterhelt D
    Ref: Genomics, 91:335, 2008 : PubMed

            

    Title: Genome sequence of Halobacterium species NRC-1
    Ng WV, Kennedy SP, Mahairas GG, Berquist B, Pan M, Shukla HD, Lasky SR, Baliga NS, Thorsson V and DasSarma S <33 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 97:12176, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer