Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: helam-a0a2w1b5z2

Helicoverpa armigera (Cotton bollworm) (Heliothis armigera) Lipase domain-containing protein

Relationship
Family|Insect_lipase
Block| L
Position in NCBI Life Tree|Helicoverpa armigera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Heliothinae: N E > Helicoverpa: N E > Helicoverpa armigera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: DGDG, KM043, MGDG
No inhibitor
2 Genbank : PZC70751, XP_021199604
1 UniProt : A0A2W1B5Z2
1 UniProt : A0A2W1B5Z2
1 Interpro : A0A2W1B5Z2
1 Prodom : A0A2W1B5Z2
1 Pfam : A0A2W1B5Z2
1 PIRSF : A0A2W1B5Z2
1 SUPERFAM : A0A2W1B5Z2
Sequence
Graphical view for this peptide sequence: helam-a0a2w1b5z2
Colored MSA for Insect_lipase (raw)
MEGLVFLLFGLAVVSALPHDPIIRKLDSGLRFQYMRGPDGTPHLVDLWGT
VEDLAKAARYNPDRQNVYHLFTRQNPTVSQPLLIGSEGLLGITNYSPNRR
TVVLVHGWLDSVTSDFNSVLVPAFLSAEDVNVIVVDWSAGAGTINYFTAL
ANTVPSGESVARFITWLNQATGAVPAMYHLVGHSLGGHQVGIIGRNVGGQ
IAYITGLDPAFPGWNTNNDKFRPTDGVYTEVIHTNVGLLGYMATLADADF
YPNGGLNMPGCSTQECDHLRSFYYMGESLRTGGFTGQRCLSYLTAMTGNC
HLWGTLRMGGLVPKTGQSGIYYLETNASPPFSRG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEGLVFLLFGLAVVSALPHDPIIRKLDSGLRFQYMRGPDGTPHLVDLWGT
VEDLAKAARYNPDRQNVYHLFTRQNPTVSQPLLIGSEGLLGITNYSPNRR
TVVLVHGWLDSVTSDFNSVLVPAFLSAEDVNVIVVDWSAGAGTINYFTAL
ANTVPSGESVARFITWLNQATGAVPAMYHLVGHSLGGHQVGIIGRNVGGQ
IAYITGLDPAFPGWNTNNDKFRPTDGVYTEVIHTNVGLLGYMATLADADF
YPNGGLNMPGCSTQECDHLRSFYYMGESLRTGGFTGQRCLSYLTAMTGNC
HLWGTLRMGGLVPKTGQSGIYYLETNASPPFSRG


Reference
    Title: The digestion of galactolipids and its ubiquitous function in Nature for the uptake of the essential alpha-linolenic acid
    Sahaka M, Amara S, Wattanakul J, Gedi MA, Aldai N, Parsiegla G, Lecomte J, Christeller JT, Gray D and Carriere F <2 more author(s)>
    Ref: Food Funct, 11:6710-6744, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer